KEGG   Escherichia coli O17 K52 H18 UMN026 (ExPEC): ECUMN_0222
Entry
ECUMN_0222        CDS       T00831                                 

Definition
(RefSeq) hypothetical protein
  KO
K11906  type VI secretion system protein VasD
Organism
eum  Escherichia coli O17:K52:H18 UMN026 (ExPEC)
Pathway
eum03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:eum00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    ECUMN_0222
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:eum02044]
    ECUMN_0222
Secretion system [BR:eum02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   ECUMN_0222
SSDB
Motif
Pfam: T6SS-SciN
Other DBs
NCBI-GeneID: 7154625
NCBI-ProteinID: YP_002410993
UniProt: B7N887
Position
complement(253999..254523)
AA seq 174 aa
MNGKAFLACVLMSVVLTGCETAKKISQVIRNPDIQVGKLMDQSTELTVTLLTEPDSNLTA
DGEAAPVDVQLVYLSDDSKFQAADYDQIATTALPDVLGKNYIDHQDFNLLPDTVKTLPPI
KLDEKTGYIGVIAYFSDDQATEWKQIEPVESIGHHYRLLVHIRASAIEMKKEEN
NT seq 525 nt   +upstreamnt  +downstreamnt
atgaacggcaaagcgtttctggcctgcgttctgatgagcgttgtgttaactggctgtgaa
acagcgaaaaaaatcagccaggtgatccgcaatccggatattcaggtcggaaagctgatg
gatcagtcaaccgagctgaccgtcacgctgctgaccgagccggacagcaacctgacggcg
gacggtgaagccgcgccggtggatgtccagttggtgtatctgagcgacgactccaaattc
caggccgccgattacgatcagattgccaccaccgcgctgcccgacgtgctggggaagaac
tatatcgatcaccaggacttcaacctgttgccggacaccgtaaaaacactgccgccgatc
aagctggatgagaaaaccggttatatcggtgtcattgcctatttttcagacgaccaggcc
acagaatggaaacaaattgagccggtagaaagtatcggccaccactatcgcctgctggtg
catatccgcgccagtgcgattgagatgaaaaaagaggaaaactga

DBGET integrated database retrieval system