KEGG   Escherichia coli O17 K52 H18 UMN026 (ExPEC): ECUMN_0226Help
Entry
ECUMN_0226        CDS       T00831                                 

Definition
(RefSeq) hypothetical protein
  KO
K11905  type VI secretion system protein
Organism
eum  Escherichia coli O17:K52:H18 UMN026 (ExPEC)
Brite
KEGG Orthology (KO) [BR:eum00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:eum02044]
    ECUMN_0226
Secretion system [BR:eum02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   ECUMN_0226
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GPW_gp25
Motif
Other DBs
NCBI-GeneID: 7154629
NCBI-ProteinID: YP_002410997
UniProt: B7N891
Position
complement(258677..259102)
Genome map
AA seq 141 aa AA seqDB search
MQRRDSGPTSSLFERIREAANPPSYQNTKEALIRSIRRNLRQVLNTRSGSCYGSPELGIT
DLNDESLASSDFRREIRKSISQCILHYEPRITDVVVTAAAPDEYAPVELRFHIVATVDVS
ETRGVFEFDILLDNHQRYCVE
NT seq 426 nt NT seq  +upstreamnt  +downstreamnt
atgcaaagacgggattcagggccaaccagcagtctttttgaacgtattcgtgaggcggcc
aacccgccttcataccagaatacaaaagaagcactgatacgttccatcagacgtaacctg
cgacaggtcctgaatacccgctccggcagttgttatggctcaccagagctggggattact
gatttaaatgatgaatcgctggcctccagcgatttcagacgagaaatccgtaagtccatt
agccagtgcattttacattacgaacctcgtattaccgatgttgttgttacggctgcggca
ccggatgaatacgcccctgtggaactacgttttcatattgtggctacggtcgatgtcagc
gaaaccaggggagtgtttgaatttgacattttgctggacaatcatcaacgctattgtgtg
gagtga

DBGET integrated database retrieval system