KEGG   Escherichia coli O17 K52 H18 UMN026 (ExPEC): ECUMN_0227Help
Entry
ECUMN_0227        CDS       T00831                                 

Definition
(RefSeq) hypothetical protein
  KO
K11900  type VI secretion system protein ImpC
Organism
eum  Escherichia coli O17:K52:H18 UMN026 (ExPEC)
Brite
KEGG Orthology (KO) [BR:eum00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:eum02044]
    ECUMN_0227
Secretion system [BR:eum02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   ECUMN_0227
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: VipB
Motif
Other DBs
NCBI-GeneID: 7154630
NCBI-ProteinID: YP_002410998
UniProt: B7N892
Position
complement(259107..260591)
Genome map
AA seq 494 aa AA seqDB search
MSVKEDIAPVSASQTAAPPSLLDEIMAQTRVQPKSESYDITRQGVSAFIAAMLQGDSSAE
PINILAVDAMIADIDARTSRQMDAIIHAPEFQELESLLRSLKLLVERADTRENIKVHFLN
VTQEELLDDFEFAPEITQSAYYKHVYSSGYGQFGGEPVAAVIGNFAFKNTTPDMKLLKYI
SQVSAMAHSPFLSSVSSEFFGLDSWTELPGIKEPGAIFEGPAYSRWRALRESEDSRYLGL
TAPRFLLRHPYSPDENPARTFRYHEDVSQSHESYLWGNTSFLLAANLAESFAKYRWCPNI
IGPSSGGAVKDLPVHLYESMGQMQAKIPTEVLITDRREYELAEEGFITLTMRKGSDNACF
FSANSVQKPKKFPKTPEGKAAETNYKLGTQLPYLFVISRLAHYIKVIQREQLGSWKERSD
LERELNTWIRQYVADQENPPAEVRSHRPLRQAKIEVLDVDGEPGWYQVAISVRPHFKYMG
ASFDLSLVGRLDKE
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgtcagtaaaggaagatattgctcccgtcagcgcgtcgcaaaccgccgcgcccccatct
ctgcttgatgaaatcatggcgcaaacccgcgtccagcctaaatcagaaagctacgatatc
acccgccagggcgtgagcgcctttattgccgccatgttacagggcgacagtagcgctgaa
cctatcaatatcctggccgttgacgccatgattgctgatattgatgcccgaaccagcagg
cagatggatgccattattcatgccccggagtttcaggaactggaatccctgctgcgctcg
ctgaagctgctggttgaacgcgcggatacacgggaaaacatcaaggtccatttcctgaat
gtcactcaggaagaactgctggatgatttcgaatttgcacctgaaatcacgcagtctgcg
tattacaagcatgtatattcaagcggttacggacaatttggcggtgagccagtggcggcg
gtaatcggcaactttgcctttaagaacaccacgccggatatgaagttgctgaaatatatc
agccaggtcagtgcgatggcgcacagcccgttcctctcatcagtatcatccgaatttttc
ggtctggactcatggacagagttaccagggatcaaagaaccaggagcaatctttgaaggc
ccggcctattcccgctggcgtgccttgcgtgaatctgaagattcacgctacctgggactg
actgccccccggttcctgctgcgtcacccttactcgccagatgagaacccagccaggacc
ttccgttaccatgaagacgtcagccagagtcacgagtcttatttgtgggggaacacctcg
tttttactagctgcgaacctggctgaaagttttgctaaatatcgctggtgtcccaatatc
attggcccttccagcggcggcgcagtcaaagacctcccggtgcatctgtatgaatccatg
gggcaaatgcaggcaaaaattccgactgaagtgttgatcactgaccggagagagtatgag
ctggcggaagaaggctttatcacactgaccatgcgtaaaggatctgataatgcgtgcttt
ttctcggccaactcggtgcagaaacccaaaaaattccccaaaacccccgaaggcaaggct
gcggagaccaactataaactcggcactcagctgccatacttatttgtaatcagtaggtta
gcgcattacatcaaggtaattcagcgcgaacagcttggctcatggaaagaacgcagtgac
ctggagcgtgagctgaacacctggattcgccagtatgtggccgaccaggagaatccgcct
gccgaagtccgcagccaccgaccattacgtcaggcgaagatcgaggtacttgatgtggat
ggtgagccaggctggtaccaggtcgcgatttctgtcagaccgcattttaaatacatgggt
gccagtttcgacctgagtctggtcggacgactggataaggaataa

DBGET integrated database retrieval system