KEGG   Escherichia coli O17 K52 H18 UMN026 (ExPEC): ECUMN_0228
Entry
ECUMN_0228        CDS       T00831                                 

Definition
(RefSeq) hypothetical protein
  KO
K11901  type VI secretion system protein ImpB
Organism
eum  Escherichia coli O17:K52:H18 UMN026 (ExPEC)
Brite
KEGG Orthology (KO) [BR:eum00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:eum02044]
    ECUMN_0228
Secretion system [BR:eum02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   ECUMN_0228
SSDB
Motif
Pfam: T6SS_VipA
Other DBs
NCBI-GeneID: 7154631
NCBI-ProteinID: YP_002410999
UniProt: B7N893
Position
complement(260614..261117)
AA seq 167 aa
MSKMNNNGGSVAPKERISVRYTPKVDGVAADIELPLNLLITGNLKGKPDNTPLDERTAIA
INRYNLNAVISEADIEREFVVPAELSDAPNEQMYVNLKVKSMDDLSPDHIASQVPEIKRL
LELREALVALKSPLGNIPAFRAQLQALLENEDSREQLIQELGIAAQK
NT seq 504 nt   +upstreamnt  +downstreamnt
atgagcaaaatgaacaacaatggcggcagtgtcgcgccgaaagaaagaatcagcgttcgg
tatacaccaaaagttgatggggtggctgctgatatcgaattgccgctgaatttattgatc
accggcaatctgaaagggaaaccagataacacgccgttggacgagcgaactgccattgct
atcaaccgctataacctcaacgcagtcatttcagaagctgacattgaacgggagtttgtt
gttccggctgaactcagtgacgctcccaatgagcaaatgtacgtcaacctgaaagtcaaa
tctatggatgacctttctccggaccatattgccagccaggtaccagaaataaaacgtctg
ctcgaattgcgtgaagctctggtcgcacttaagtctccactaggcaatattccggccttc
cgcgcacaacttcaggcgctactggaaaacgaagacagccgcgagcagctgatccaagaa
ctgggtatcgccgctcagaaataa

DBGET integrated database retrieval system