KEGG   Escherichia coli O17 K52 H18 UMN026 (ExPEC): ECUMN_0308Help
Entry
ECUMN_0308        CDS       T00831                                 

Gene name
proB
Definition
(RefSeq) gamma-glutamate kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
eum  Escherichia coli O17:K52:H18 UMN026 (ExPEC)
Pathway
eum00330  Arginine and proline metabolism
eum00332  Carbapenem biosynthesis
eum01100  Metabolic pathways
eum01130  Biosynthesis of antibiotics
eum01230  Biosynthesis of amino acids
Module
eum_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:eum00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    ECUMN_0308 (proB)
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    ECUMN_0308 (proB)
Enzymes [BR:eum01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     ECUMN_0308 (proB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA
Motif
Other DBs
NCBI-GeneID: 7157457
NCBI-ProteinID: YP_002411077
UniProt: B7N8H3
Structure
PDB: 

Position
333049..334152
Genome map
AA seq 367 aa AA seqDB search
MSDSQTLVVKLGTSVLTGGSRRLNRAHIVELVRQCAQLHAAGHRIVIVTSGAIAAGREHL
GYPELPATIASKQLLAAVGQSRLIQLWEQLFSIYGIHVGQMLLTRADMEDRERFLNARDT
LRALLDNNIVPVINENDAVATAEIKVGDNDNLSALAAILAGADKLLLLTDQKGLYTADPR
SNPQAELIKDVYGIDDALRAIAGDSVSGLGTGGMSTKLQAADVACRAGIDTIIAAGSKPG
VIGDVMEGISVGTLFHAQATPLENRKRWIFGAPPAGEITVDEGATAAILERGSSLLPKGI
KSVTGNFSRGEVIRICNLEGRDIAHGVSRYNSDALRRIAGHHSQEIDAILGYEYGPVAVH
RDDMITR
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgagtgacagccagacgctggtggtaaaactcggcaccagtgtgctaacaggcggatcg
cgccgtctgaaccgtgcccatatcgttgaacttgttcgccagtgcgcgcagttacatgcc
gccgggcatcggattgttattgtgacgtcgggcgcgatcgccgccggacgtgagcaccta
ggttacccggaactgccagcgactatcgcctcgaaacaactgctggcggcggtagggcag
agtcgactgattcaactgtgggaacagctgttttcgatttatggcattcacgtcgggcaa
atgctgctgacccgtgctgatatggaagaccgtgaacgcttcctgaacgcccgcgacacc
ctgcgagcgttgctcgataacaatatcgttccggtaatcaatgagaacgatgctgtcgct
actgcagagattaaggtcggcgataacgataacctttctgcgctggcggcgattctggcg
ggtgccgataaactgttgctgctgaccgatcaaaaaggtttgtataccgctgacccgcgc
agcaatccgcaggcagaactgattaaagatgtttacggcattgatgacgcactgcgcgcg
attgctggcgacagcgtttcaggcctcggaactggcggcatgagtaccaaattgcaggcc
gcggacgtggcttgccgtgcgggtatcgacaccattattgccgcgggcagcaagccgggc
gttattggtgatgtgatggaaggcatttccgtcggtaccctgtttcatgcccaggcgacc
ccgcttgaaaaccgtaaacgctggattttcggtgcaccacctgcgggtgaaatcacggta
gatgaaggggcaaccgccgccattcttgaacgcggcagctccctgttgccgaaaggtatt
aaaagcgtgactggcaatttctcgcgtggtgaagtcatccgcatttgcaacctcgaaggt
cgcgatatcgcccacggcgtcagtcgttacaacagcgatgcattacgccgtattgctgga
caccactcgcaagaaattgatgcaatactgggatatgaatatggcccggttgccgttcac
cgtgatgacatgattacccgttaa

DBGET integrated database retrieval system