KEGG   Escherichia coli O17 K52 H18 UMN026 (ExPEC): ECUMN_1559Help
Entry
ECUMN_1559        CDS       T00831                                 

Gene name
trpA
Definition
(RefSeq) tryptophan synthase, alpha subunit
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
eum  Escherichia coli O17:K52:H18 UMN026 (ExPEC)
Pathway
eum00260  Glycine, serine and threonine metabolism
eum00400  Phenylalanine, tyrosine and tryptophan biosynthesis
eum01100  Metabolic pathways
eum01110  Biosynthesis of secondary metabolites
eum01130  Biosynthesis of antibiotics
eum01230  Biosynthesis of amino acids
Module
eum_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:eum00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ECUMN_1559 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    ECUMN_1559 (trpA)
Enzymes [BR:eum01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     ECUMN_1559 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth
Motif
Other DBs
NCBI-GeneID: 7158574
NCBI-ProteinID: YP_002412302
UniProt: B7N473
Structure
PDB: 

Position
complement(1568249..1569055)
Genome map
AA seq 268 aa AA seqDB search
MERYESLFAQLKERKEGAFVPFVTLGDPGIEQSLKIIDTLIEAGADALELGIPFSDPLAD
GPTIQNATLRAFAAGVTPAQCFEMLALIRQKHPTIPIGLLMYANLVFSKGIDEFYAQCEK
VGVDSVLVADVPVEESAPFRQAALRHNVAPIFICPPNADDDLLRQIASYGRGYTYLLSRA
GVTGAENRAALPLNHLVTKLKEYNAAPPLQGFGISAPDQVKAAIDAGAAGAISGSAIVKI
IEQHINEPEKMLVALKAFVQPMKAATRS
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atggaacgctacgaatctctgtttgcccagttgaaggagcgcaaagaaggcgcattcgtt
cctttcgtcacgctcggtgatccgggcattgagcagtcgctgaaaattatcgacacgcta
attgaagccggtgctgacgcgctggagttaggtatccccttctccgacccactggcggat
ggcccgacgattcaaaacgccacactgcgtgcctttgcggcaggtgtgaccccggcacag
tgctttgagatgctggcactgattcgccagaagcacccgaccattcccatcggccttttg
atgtatgccaacctggtgtttagcaaaggcattgatgagttttatgcccagtgcgagaaa
gtcggcgtcgattcggtgctggttgccgatgtgccagtggaagagtccgctcccttccgc
caggccgcgttgcgtcataatgtcgcacctatctttatttgcccgccgaatgccgacgat
gatttgctgcgccagatagcctcctacggtcgtggatacacctatttattgtcacgtgcg
ggcgtgaccggcgcagaaaaccgcgccgcgttacccctcaatcatctggtcacgaagctg
aaagagtacaatgctgcgcctccattgcagggctttggtatttccgccccggatcaggta
aaagcagcgattgatgcaggagctgcaggcgcgatttcaggttcagccattgttaaaatc
atcgagcaacatattaatgagccagagaaaatgctggtggcactgaaagcttttgtacaa
ccgatgaaagcggctacgcgcagttaa

DBGET integrated database retrieval system