KEGG   Escherichia coli O17 K52 H18 UMN026 (ExPEC): ECUMN_1560Help
Entry
ECUMN_1560        CDS       T00831                                 

Gene name
trpB
Definition
(RefSeq) tryptophan synthase, beta subunit
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
eum  Escherichia coli O17:K52:H18 UMN026 (ExPEC)
Pathway
eum00260  Glycine, serine and threonine metabolism
eum00400  Phenylalanine, tyrosine and tryptophan biosynthesis
eum01100  Metabolic pathways
eum01110  Biosynthesis of secondary metabolites
eum01130  Biosynthesis of antibiotics
eum01230  Biosynthesis of amino acids
Module
eum_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:eum00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ECUMN_1560 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    ECUMN_1560 (trpB)
Enzymes [BR:eum01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     ECUMN_1560 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-GeneID: 7158117
NCBI-ProteinID: YP_002412303
UniProt: B7N474
Structure
PDB: 

Position
complement(1569055..1570248)
Genome map
AA seq 397 aa AA seqDB search
MTTLLNPYFGEFGGMYVPQILMPALRQLEEAFVSAQKDPEFQAQFNDLLKNYAGRPTALT
KCQNITAGTNTTLYLKREDLLHGGAHKTNQVLGQALLAKRMGKTEIIAETGAGQHGVASA
LASALLGLKCRIYMGAKDVERQSPNVFRMHLMGAEVIPVHSGSATLKDACNEALRDWSGS
YETAHYMLGTAAGPHPYPTIVREFQRMIGEETKAQILEREGRLPDAVIACVGGGSNAIGM
FADFINETDVGLIGVEPGGHGIETGEHGAPLKHGRVGIYFGMKAPMMQTEDGQIEESYSI
SAGLDFPSVGPQHAYLNSTGRADYVSITDDEALEAFKTLCLHEGIIPALESSHALAHALK
MMRENPEKEQLLVVNLSGRGDKDIFTVHDILKARGEI
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgacaacattacttaacccctattttggtgagtttggcggcatgtacgtgccacaaatc
ctgatgcctgctctgcgccagctggaagaagcttttgtcagcgcgcaaaaagatcctgaa
tttcaggcccagttcaacgacctgctgaaaaactatgccgggcgtccaaccgcactcacc
aaatgccagaacatcacggctggcactaacaccacgctgtatctcaagcgcgaagatttg
ctgcacggcggcgcgcataaaactaaccaggtgctcggtcaggctttactggcgaagcgg
atgggtaaaaccgaaatcatcgccgaaaccggtgccggtcagcatggcgtggcgtcggcc
cttgccagcgccctgctcggcctgaaatgccgtatttatatgggtgccaaagacgttgaa
cgccagtcgcctaacgtttttcgtatgcatttaatgggcgcggaagtgatcccggtgcat
agcggttccgcgacgctgaaagatgcctgtaatgaggcgctgcgcgactggtccggcagt
tatgaaaccgcgcactatatgctgggcaccgcagctggcccacatccttatccgaccatt
gtccgtgagttccagcggatgattggcgaagaaaccaaagcacagattctggaaagagaa
ggtcgcctgccggatgcggttatcgcttgtgttggcggcggttcaaatgccatcggcatg
tttgctgattttatcaacgaaaccgacgtcggcctgattggtgtcgaaccaggcggtcac
ggtatcgaaactggcgagcacggcgcaccgttaaaacacggtcgcgtgggcatctatttc
ggtatgaaagcgccgatgatgcaaaccgaagacggacagattgaagaatcttactccatc
tccgccggactggatttcccgtctgtcggcccacaacacgcgtatcttaacagcactgga
cgcgctgattacgtgtcaattaccgatgatgaagcactggaagccttcaaaacgctgtgc
ctgcacgaagggatcatcccggcgctggagtcctcccacgccctggcccatgcgctgaaa
atgatgcgcgaaaacccggaaaaagagcagctactggtggttaacctttccggtcgcggc
gataaagacatcttcaccgttcacgatattttgaaagcacgaggggaaatctga

DBGET integrated database retrieval system