KEGG   Escherichia coli O17 K52 H18 UMN026 (ExPEC): ECUMN_1561Help
Entry
ECUMN_1561        CDS       T00831                                 

Gene name
trpC
Definition
(RefSeq) bifunctional indole-3-glycerol phosphate synthase/N-(5'-phospho-ribosyl)anthranilate isomerase
  KO
K13498  indole-3-glycerol phosphate synthase / phosphoribosylanthranilate isomerase [EC:4.1.1.48 5.3.1.24]
Organism
eum  Escherichia coli O17:K52:H18 UMN026 (ExPEC)
Pathway
eum00400  Phenylalanine, tyrosine and tryptophan biosynthesis
eum01100  Metabolic pathways
eum01110  Biosynthesis of secondary metabolites
eum01130  Biosynthesis of antibiotics
eum01230  Biosynthesis of amino acids
Module
eum_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:eum00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    ECUMN_1561 (trpC)
Enzymes [BR:eum01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     ECUMN_1561 (trpC)
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.24  phosphoribosylanthranilate isomerase
     ECUMN_1561 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS PRAI QRPTase_C
Motif
Other DBs
NCBI-GeneID: 7158118
NCBI-ProteinID: YP_002412304
UniProt: B7N475
Structure
PDB: 

Position
complement(1570260..1571618)
Genome map
AA seq 452 aa AA seqDB search
MQTVLAKIVADKAIWVETRKEQQPLASFQNEVQPSTRHFYDALQGARTSFILECKKASPS
KGVIRDDFDPARIAAIYKHYASAISVLTDEKYFQGSFDFLPIVSQIAPQPILCKDFIIDP
YQIYLARYYQADACLLMLSVLDDEQYRQLAAVAHSLEMGVLTEVSNEEELERAIALGAKV
VGINNRDLRDLSIDLNRTRELAPKLGHNVTVISESGINTYAQVRELSHFANGFLIGSALM
AHDDLNAAVRRVLLGENKVCGLTRGQDAKAAYDAGAIYGGLIFVATSPRCVNVEQAQEVM
AAAPLQYVGVFRNHDIADVVDKAKVLSLAAVQLHGNEDQQYIDTLRGALPANIAIWKALS
VGETLPARELQHVDKYVLDNGQGGSGQRFDWSLLNGQSLGNVLLAGGLGADNCVEAAQTG
CAGLDFNSAVESQPGIKDARLLASVFQTLRAY
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaccgttttagcgaaaatcgtcgcagacaaggcgatttgggtagaaacccgcaaa
gagcagcaaccgctggccagttttcagaatgaggttcagccgagcacgcgacatttttat
gatgcacttcagggtgcacgcacgtcgtttattctggagtgcaaaaaagcgtcgccgtca
aaaggcgtgatccgtgatgatttcgatccggcacgcattgccgccatttataaacattac
gcttcggcaatttcggtgctgactgatgagaaatattttcaggggagctttgatttcctc
cccatcgtcagccaaatcgccccgcagccgattttatgtaaagacttcattatcgatcct
taccagatctatctggcgcgctattaccaggccgatgcctgcttattaatgctttcagta
ctggatgacgaacaatatcgccagcttgctgccgtcgcccacagtctggagatgggtgtg
ctgaccgaagtcagtaatgaagaggaactggagcgtgccattgcattgggggcaaaggtc
gttggcatcaacaaccgcgatctgcgtgatttgtcgattgatctcaaccgtacccgcgag
cttgcgccgaaactggggcacaacgtgacggtaatcagcgaatccggcatcaatacttac
gctcaggtgcgcgagttaagccacttcgctaacggttttctgattggttcggcgttgatg
gcccatgacgatttgaacgccgccgtgcgccgggtgttgctgggtgagaataaagtatgt
ggcctgacgcgtgggcaagatgctaaagcagcttatgacgcgggcgcgatttacggtggg
ttgatttttgttgcgacatcaccgcgttgcgtcaacgttgaacaggcgcaggaagtgatg
gctgcggcaccgttgcagtatgttggcgtgttccgcaatcacgatattgccgatgtggtg
gacaaagctaaggtgttatcacttgcggcagtgcaactgcatggtaatgaagatcaacaa
tatatcgacacattgcgtggcgcgctgcccgcaaacattgccatctggaaagcattaagc
gtcggtgaaaccctgcccgcccgcgagcttcagcacgttgataaatatgttttagacaac
ggccagggtggaagcgggcaacgtttcgactggtcactgttaaacggtcaatcgcttggc
aacgttctgctggcggggggcttaggcgcagataactgcgtggaagcggcacaaaccggc
tgcgccggacttgattttaattctgctgtagagtcgcaaccgggcatcaaagacgcacgt
cttttggcctcggttttccagacgctgcgcgcatattaa

DBGET integrated database retrieval system