KEGG   Escherichia coli O17 K52 H18 UMN026 (ExPEC): ECUMN_2651Help
Entry
ECUMN_2651        CDS       T00831                                 

Gene name
ubiX
Definition
(RefSeq) 3-octaprenyl-4-hydroxybenzoate carboxy-lyase
  KO
K03186  flavin prenyltransferase [EC:2.5.1.129]
Organism
eum  Escherichia coli O17:K52:H18 UMN026 (ExPEC)
Pathway
eum00130  Ubiquinone and other terpenoid-quinone biosynthesis
eum00627  Aminobenzoate degradation
eum01100  Metabolic pathways
eum01110  Biosynthesis of secondary metabolites
eum01120  Microbial metabolism in diverse environments
eum01220  Degradation of aromatic compounds
Module
eum_M00117  Ubiquinone biosynthesis, prokaryotes, chorismate => ubiquinone
Brite
KEGG Orthology (KO) [BR:eum00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    ECUMN_2651 (ubiX)
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    ECUMN_2651 (ubiX)
Enzymes [BR:eum01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.129  flavin prenyltransferase
     ECUMN_2651 (ubiX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Flavoprotein
Motif
Other DBs
NCBI-GeneID: 7155781
NCBI-ProteinID: YP_002413360
UniProt: B7N5S3
Position
complement(2727398..2727967)
Genome map
AA seq 189 aa AA seqDB search
MKRLIVGISGASGAIYGVRLLQVLRDVADVETHLVMSQAARQTLSLETDFSLREVQALAD
VTHDARDIAASISSGSFQTLGMVILPCSIKTLSGIVHSYTDGLLTRAADVVLKERRPLVL
CVRETPLHLGHLRLMTQAAEIGAVIMPPVPAFYHRPQSLDDVINQTVNRVLDQFAITLPE
DLFARWQGA
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgactcattgtaggcatcagcggtgccagcggcgcgatttatggcgtgcgctta
ttacaggttctgcgcgatgtcgcagatgttgaaacgcatctggtgatgagccaggccgcg
cgccagaccttatccctcgaaacggatttttccctgcgcgaagtgcaggcattagccgat
gtgacgcacgatgcgcgcgatattgctgccagcatttcttccggttctttccagacactg
gggatggtgattttaccctgttcaatcaaaaccctgtccggcattgtccatagctatact
gatggcttactgacccgtgcggcagatgttgtgctgaaagagcgtcgcccgttggtgctc
tgcgtacgtgaaacaccattgcacttaggccatctgcgtttaatgacgcaggcagcagaa
atcggtgcggtgattatgcctcccgttccggcgttttatcatcgcccgcaatcccttgat
gatgtgataaatcagacggttaaccgtgtactcgatcaattcgccataacgcttcctgaa
gatctctttgcccgctggcagggcgcataa

DBGET integrated database retrieval system