KEGG   Escherichia coli O17 K52 H18 UMN026 (ExPEC): ECUMN_3209
Entry
ECUMN_3209        CDS       T00831                                 

Gene name
xdhA
Definition
(RefSeq) xanthine dehydrogenase molybdenum binding subunit
  KO
K00087  xanthine dehydrogenase molybdenum-binding subunit [EC:1.17.1.4]
Organism
eum  Escherichia coli O17:K52:H18 UMN026 (ExPEC)
Pathway
eum00230  Purine metabolism
eum01100  Metabolic pathways
eum01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:eum00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    ECUMN_3209 (xdhA)
Enzymes [BR:eum01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.1  With NAD+ or NADP+ as acceptor
    1.17.1.4  xanthine dehydrogenase
     ECUMN_3209 (xdhA)
SSDB
Motif
Pfam: Ald_Xan_dh_C2 Ald_Xan_dh_C
Other DBs
NCBI-GeneID: 7159030
NCBI-ProteinID: YP_002413892
UniProt: B7N7B1
Position
3322865..3325162
AA seq 765 aa
MEAREATATGESCMRVDAIAKVTGRARYTDDYVMAGMCYAKYVRSPIAHGYAVSINDEQA
RSLPGVLAIFTWEDVPDIPFATAGHAWTLDENKRDTADRALLTRHVRHHGDAVAIVVARD
ELTAEKAAQLVSIEWQELPVITTPEAALADDAEPIHNGGNLLKQSTMTTGNVQQTIDAAD
YQVQGHYQTPVIQHCHMESVTSLAWMEDDSRITIVSSTQIPHIVRRVVGQALNIPWSCVR
VIKPFVGGGFGNKQDVLEEPMAAFLTSKLGGIPVKVSLSREECFLATRTRHAFTIDGQMG
VNRDGTLKGYSLDVLSNTGAYASHGHSIASAGGNKVAYLYPRCAYAYSSKTCYTNLPSAG
AMRGYGAPQVVFAVESMLDDAATALGIDPVEIRLRNAAREGDANPLSGKRIYSAGLPECL
EKGRKIFEWEKRRAECQNQQGNLRRGVGVACFSYTSNTWPVGVEIAGARLLMNQDGTINV
QSGATEIGQGADTVFSQMVAETVGVPVSDVRVISTQDTDVTPFDPGAFASRQSYVAAPAL
RSAALLLKEKIIAHAAVMLHQSAMNLTLIKGHIVLVERPEEPLMSLKDLAMDAFYHPERG
GQLSAESSIKTTTNPPAFGCTFVDLTIDIALCKVTINRILNVHDSGHILNPLLAEGQVHG
GMGMGIGWALFEEMIIDAKSGVVRNPNLLDYKMPTMPDLPQLESAFVEINEPQSAYGHKS
LGEPPIIPVAAAIRNAVKMATGVAINTLPLTPKRLYEEFHLAGLI
NT seq 2298 nt   +upstreamnt  +downstreamnt
atggaagcgcgggaagcaaccgctacaggtgaatcatgcatgcgcgtagatgccattgct
aaggtcaccgggcgggcacgatatactgacgattatgttatggcgggcatgtgttacgcg
aaatatgtacgtagccctatcgcacatggttatgccgtaagtattaatgatgaacaagcc
agaagtttaccgggcgtactggcgatttttacctgggaagatgtgcctgatatcccattc
gctacagctgggcatgcctggacacttgacgaaaacaagcgcgataccgccgatcgtgcc
ctgctaactcgccatgttcgtcaccatggtgacgccgttgccatcgtcgtggcccgtgat
gaactcacggcagaaaaagcggcgcaattggtcagcattgagtggcaagaattacccgtt
atcaccaccccagaagcggcgctggctgatgacgctgaaccaatccataatggcggcaat
ttactaaaacaaagcacgatgacgacgggcaatgtccaacaaacaatcgatgccgccgac
taccaggtacaggggcactatcagacgccggtcattcaacattgtcacatggaaagcgtg
acatcgctggcatggatggaggatgactcgcgaattaccatcgtttccagcacccagatc
ccgcacattgttcgccgtgtggttggtcaggcgctgaatattccctggtcatgcgtacga
gtcatcaaaccgtttgtcggtggcggttttggtaataaacaggatgtactggaagagcca
atggcagcattcctgaccagcaagcttggcggcattccggtgaaagtttcccttagccgt
gaagagtgtttcctcgcaacccgtacccgccacgcttttactattgacgggcaaatgggc
gtgaaccgcgacggaacattgaaaggttatagtctggatgttctgtctaacaccggcgct
tatgcatctcacgggcactccatcgcttctgcaggggggaataaagtcgcttacctttat
cctcgttgtgcctacgcttacagttcaaagacctgctataccaacctcccctcggctggt
gcgatgcgtggttatggcgcgccacaagtcgtatttgccgttgagtctatgcttgatgac
gccgcgacagcgttaggtattgatcctgttgaaattcgtttacgcaacgccgcccgcgaa
ggagatgctaatccgctctcgggcaaacgtatttacagcgcagggttgccggagtgtctt
gaaaaaggccggaaaatctttgaatgggaaaaacgccgtgcagaatgccagaaccagcaa
ggcaatttacgccgcggcgttggcgtcgcctgttttagctacacctctaacacctggcct
gtcggcgtagaaattgctggcgcgcgcctgttgatgaatcaggatggaaccatcaacgta
cagagtggtgccacggaaatcggccagggtgccgacaccgtgttctcgcaaatggtggca
gaaaccgtgggggttccggtcagcgacgttcgcgttatttcaacacaagataccgacgtt
acgccgttcgatcccggtgcatttgcctcgcgccagagctatgttgccgcgcccgcgctg
cgcagtgcggcactgttattaaaagagaaaatcatcgctcacgccgctgtcatgctacat
cagtcagcgatgaatcttaccttgataaaaggccatatcgtgctggttgaacgaccggaa
gagccgttaatgtcgttaaaagatttggcgatggacgctttctaccaccctgaacgcggt
gggcagctctctgccgaaagctccatcaaaaccaccactaacccaccagcgtttggctgt
acctttgttgatctgacgatcgatattgcgctgtgcaaagtcaccatcaaccgcatcctc
aacgttcatgattcgggccatattcttaatccgctactggcagaaggtcaggtacacggc
ggaatgggaatgggcattggctgggcgctatttgaagagatgatcattgatgcgaaaagc
ggcgtggtccgtaaccccaacctgctggattacaaaatgccgaccatgccggatctgcca
caactggaaagcgcgttcgtcgaaatcaatgagccgcaatccgcatacggacataagtca
ctgggtgagccaccaataattcctgttgccgctgctattcgtaacgcggtgaagatggct
accggtgttgcaatcaatacactgccgctgacgccaaaacggttatatgaagagttccat
ctggcaggattgatttga

DBGET integrated database retrieval system