KEGG   Escherichia coli O17 K52 H18 UMN026 (ExPEC): ECUMN_3211
Entry
ECUMN_3211        CDS       T00831                                 

Gene name
xdhC
Definition
(RefSeq) xanthine dehydrogenase, Fe-S binding subunit
  KO
K13480  xanthine dehydrogenase iron-sulfur-binding subunit
Organism
eum  Escherichia coli O17:K52:H18 UMN026 (ExPEC)
Pathway
eum00230  Purine metabolism
eum01100  Metabolic pathways
eum01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:eum00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    ECUMN_3211 (xdhC)
SSDB
Motif
Pfam: Fer2_2 Fer2 Fer2_3
Other DBs
NCBI-GeneID: 7158243
NCBI-ProteinID: YP_002413894
UniProt: B7N7B3
Position
3326048..3326527
AA seq 159 aa
MNHSETITIECAINGIPFQLHAAPGTPLSELLREQGLLSVKQGCCVGECGACTVLVDGTA
IDSCLYLAAWAEGKEIRTLEGEAKGGKLSHVQQAYAKSGAVQCGFCTPGLIMATTAMLAK
PREKPLTITEIRRGLAGNLCRCTGYQMIVNTVLDCEKTK
NT seq 480 nt   +upstreamnt  +downstreamnt
atgaatcacagcgaaacaattaccatcgaatgcgccattaacgggatcccttttcagctt
cacgccgcaccaggcacgccgctctcggaattactccgcgaacaaggactgctaagtgtc
aaacaagggtgctgcgtgggtgaatgtggtgcctgtacggtgctggtcgacggcacagca
atagacagttgcttataccttgccgcctgggctgaaggaaaagagatccgcacgctggaa
ggtgaagcgaaaggcggaaaactttctcatgttcagcaggcttatgcgaaatccggcgca
gtgcagtgcgggttttgtacgcctggcctgattatggctaccacagcaatgctggcgaaa
ccacgcgagaagccattaaccattacggaaattcgtcgcggactggcaggaaatctttgt
cgctgcacggggtatcagatgattgtaaatacagttctggattgcgagaaaacgaagtaa

DBGET integrated database retrieval system