KEGG   Escherichia coli O17 K52 H18 UMN026 (ExPEC): ECUMN_4111Help
Entry
ECUMN_4111        CDS       T00831                                 

Gene name
mtlD
Definition
(RefSeq) mannitol-1-phosphate dehydrogenase
  KO
K00009  mannitol-1-phosphate 5-dehydrogenase [EC:1.1.1.17]
Organism
eum  Escherichia coli O17:K52:H18 UMN026 (ExPEC)
Pathway
eum00051  Fructose and mannose metabolism
eum01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eum00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    ECUMN_4111 (mtlD)
Enzymes [BR:eum01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.17  mannitol-1-phosphate 5-dehydrogenase
     ECUMN_4111 (mtlD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mannitol_dh_C Mannitol_dh 3HCDH_N AfaD
Motif
Other DBs
NCBI-GeneID: 7157191
NCBI-ProteinID: YP_002414752
UniProt: B7NEQ1
Position
4228804..4229952
Genome map
AA seq 382 aa AA seqDB search
MKALHFGAGNIGRGFIGKLLADAGIQLTFADVNQVVLDALNARHSYQVHVVGETEQVDTV
SGVNAVSSIGDDVVDLIAQVDLVTTAVGPVVLERIAPAIAKGLVKRKEQGNESPLNIIAC
ENMVRGTTQLKGHVMNALPEDAKAWVEEHVGFVDSAVDRIVPPSASATNDPLEVTVETFS
EWIVDKTQFKGALPNIPGMELTDNLMAFVERKLFTLNTGHAITAYLGKLAGHQTIRDAIL
DEKIRAVVKGAMEESGAVLIKRYGFDADKHAAYIRKILGRFENPYLKDDVERVGRQPLRK
LSAGDRLIKPLLGTLEYGLPHKNLIEGIAAAMHFRSEDDPQAQELAALIADKGPQAALAQ
ISGLDANSEVVSEAVTAYKAMQ
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcattacattttggcgcaggtaatatcggtcgtggctttatcggtaaactgctg
gcagacgcgggtatccaactgacgtttgccgatgtcaatcaggtggtacttgatgccctg
aatgcccgtcatagctatcaggttcatgtggtcggtgaaaccgagcaggtagataccgtt
tccggcgtcaatgccgtcagcagcattggtgatgatgtcgttgatctgattgctcaggtt
gatttagtcactaccgccgttggtccggttgtgctggaacgtattgccccggcaatcgcc
aaagggctggtgaaacgtaaagaacaaggtaatgaatccccgctgaacatcatcgcctgt
gaaaacatggtacgcggcaccacgcagctgaaaggccatgtaatgaacgccctgccggaa
gatgccaaagcgtgggtagaagaacacgttggctttgtcgattccgccgttgaccgcatc
gtgccgccttcggcttctgcaaccaacgatccgctggaagtgacggtagaaacattcagc
gaatggattgttgataaaacccagttcaaaggcgcgctgccgaacatcccaggcatggag
ttaactgacaacctgatggcatttgtcgaacgtaaactcttcaccctgaacacgggtcat
gctataaccgcgtacctcggaaaactggccggtcatcagaccattcgtgacgctattctc
gacgagaaaatccgcgcggtggtaaaaggtgcgatggaagaaagtggtgcagtattgatc
aagcgctacggctttgacgcagacaaacatgcggcgtacatccggaaaatcctcggtcgt
ttcgagaacccgtatctgaaagatgatgtagagcgcgtaggccgtcagccgctgcgtaaa
ctgagtgctggcgaccgtctgatcaagccactgctcggaacgctggaatatggtctgcca
cataaaaacctgattgaaggtattgccgctgcaatgcacttccgcagtgaagatgatccg
caggctcaggaactggcagcactgatcgctgacaaaggtccgcaggcggcgctggcacag
atttccggtcttgatgccaacagcgaggttgtatccgaggcggtaaccgcttataaagca
atgcaataa

DBGET integrated database retrieval system