KEGG   Escherichia coli O17 K52 H18 UMN026 (ExPEC): ECUMN_4551Help
Entry
ECUMN_4551        CDS       T00831                                 

Definition
(RefSeq) PTS sorbose transporter subunit IIB
  KO
K02813  PTS system, sorbose-specific IIB component [EC:2.7.1.206]
Organism
eum  Escherichia coli O17:K52:H18 UMN026 (ExPEC)
Pathway
eum00051  Fructose and mannose metabolism
eum01100  Metabolic pathways
eum02060  Phosphotransferase system (PTS)
Brite
KEGG Orthology (KO) [BR:eum00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    ECUMN_4551
 09130 Environmental Information Processing
  09131 Membrane transport
   02060 Phosphotransferase system (PTS)
    ECUMN_4551
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:eum02000]
    ECUMN_4551
Enzymes [BR:eum01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.206  protein-Npi-phosphohistidine---L-sorbose phosphotransferase
     ECUMN_4551
Transporters [BR:eum02000]
 Phosphotransferase system (PTS)
  Enzyme II [TC:4.A]
   Sorbose-specific II component
    ECUMN_4551
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PTSIIB_sorb
Motif
Other DBs
NCBI-GeneID: 7155468
NCBI-ProteinID: YP_002415158
UniProt: B7NFW1
Position
complement(4722124..4722618)
Genome map
AA seq 164 aa AA seqDB search
MNITLARIDDRLIHGQVTTVWSKVANAQRIIICNDEVYNDEVRRTLLRQAAPPGMKVNVV
NIEKAVAVYHNPQYQDETVFYLFTRPQDALAMVRQGVKIDTLNIGGMAWRPGKKQLTKAV
SLDDDDINAFHELNNLGVILDLRVVASDPSINIIDKINEQLIAN
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
atgaacattacgctcgcccgcattgatgaccgcctgatccacggtcaggtcactaccgtc
tggtcgaaagtggctaacgcccagcgcattattatctgcaatgacgaagtttataacgat
gaagttcgccggacattattgcgtcaggctgcgccaccgggaatgaaggttaacgtggtc
aatattgaaaaagccgtcgcggtttatcacaacccgcaatatcaggacgaaaccgttttt
tatcttttcactcgcccacaggatgccttagcgatggttcgccagggggtaaaaatagac
accctgaatattggcggcatggcctggcggcccggtaaaaaacagttaaccaaagcggtt
tcattagatgatgatgatattaacgcatttcatgagttaaataatcttggcgtcatactg
gatttacgcgtcgtagcgtcagatccctcaatcaatattatcgacaaaataaacgaacag
ttaatcgcaaattaa

DBGET integrated database retrieval system