KEGG   Escherichia coli O17 K52 H18 UMN026 (ExPEC): p1ECUMN_0088
Entry
p1ECUMN_0088      CDS       T00831                                 

Gene name
TraQ
Definition
(RefSeq) conjugal transfer protein TraQ
Organism
eum  Escherichia coli O17:K52:H18 UMN026 (ExPEC)
SSDB
Motif
Pfam: TraQ DLP_helical DUF2207 Herpes_LMP1
Other DBs
NCBI-GeneID: 7144274
NCBI-ProteinID: YP_002405986
UniProt: B7LJ36
Position
p1ESCUM:complement(72158..72442)
AA seq 94 aa
MISKRRFSLPRLDITGMWVFSLGVWFHIVARLVYSKPWMAFFLAELIAAILVLFGAYQVL
DAWIARVSLEEREALEARQQAMMEGQQEGGHVSH
NT seq 285 nt   +upstreamnt  +downstreamnt
atgataagtaaacgcagattctctttaccacggcttgatattacgggaatgtgggtattt
tccctgggtgtctggtttcatatcgtcgcccgtcttgtttacagcaaaccctggatggct
ttttttctggcggagttgattgcggccatccttgtgctgttcggcgcataccaggtgctg
gatgcatggattgcacgtgtcagcctggaagagcgtgaggcactggaagccaggcaacag
gccatgatggaagggcagcaggagggcggacatgtctctcactaa

DBGET integrated database retrieval system