KEGG   Escherichia coli O17 K52 H18 UMN026 (ExPEC): p1ECUMN_0095
Entry
p1ECUMN_0095      CDS       T00831                                 

Gene name
traU
Definition
(RefSeq) conjugal transfer protein TraU
  KO
K12060  conjugal transfer pilus assembly protein TraU
Organism
eum  Escherichia coli O17:K52:H18 UMN026 (ExPEC)
Brite
KEGG Orthology (KO) [BR:eum00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:eum02044]
    p1ECUMN_0095 (traU)
Secretion system [BR:eum02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   p1ECUMN_0095 (traU)
SSDB
Motif
Pfam: TraU
Other DBs
NCBI-GeneID: 7144351
NCBI-ProteinID: YP_002405992
UniProt: B7LJ42
Position
p1ESCUM:complement(77043..78035)
AA seq 330 aa
MKRSLWLLMLFLLAGHVPAASADSACEGRFVNPITDICWSCIFPLSLGSIKVSQGKVPDT
ANPSMPIQICPAPPPLFRRIGLAIGYWEPMALTDVTRSPGCMVNLGFSLPAFGKTAQGTA
KKDEKQVNGAFYHVHWYKYPLTYWLNIITSLGCLEGGDLDIAYLSEIDPTWTDSSLTTIL
NPEAVIFANPIAQGACAADAIASAFNMPLDVLFWCAGSQGSMYPFNGWVSNESSPLQSSL
LVSERMAFKLHRQGMIMETIGKNNAVCNEYPSPILPKERWRYQMVNMYPDSGQCHPFGRS
VMRWETGKNPPNTKKNFGYLMWRKRNCVFL
NT seq 993 nt   +upstreamnt  +downstreamnt
atgaagcgaagcctgtggctgctgatgttattccttctcgccggtcatgtccctgcggca
tctgcggattctgcctgtgaggggcgttttgtaaacccgatcacggatatctgctggagc
tgtattttcccgctctcgctgggcagtatcaaagtcagtcagggtaaggtccccgacacg
gcgaacccgtcgatgcccattcagatttgtccggcaccgccgccgctgttcaggcgtatc
gggctggccattggttactgggagccgatggcgctgacggacgtcacccggtcaccggga
tgcatggtgaacctgggcttcagcctgccggcttttggtaaaacggcacagggaacggcg
aaaaaggatgagaagcaggtgaacggggcgttctatcacgttcactggtacaaatacccg
ctgacgtactggcttaacatcatcacatcgctgggctgtctggaaggtggtgacctggat
atcgcttatctttctgaaattgaccccacctggacggacagcagcctgaccaccattctc
aatccggaagctgtcatctttgccaatccgatagcacagggggcctgcgcagcagatgcc
attgccagtgcctttaatatgcctctcgatgttctgttctggtgtgccggttcgcagggc
agtatgtacccgttcaatggctgggtgagtaatgagtccagtccgttgcagtcctccctg
ctggtcagtgaacgcatggcattcaagctgcaccgtcagggcatgattatggaaaccatc
gggaaaaataacgccgtctgtaatgaatatccgtccccaatcctgcctaaagaacgctgg
cgttatcagatggtgaatatgtatccggacagcggacagtgccatccgttcgggcgcagt
gtgatgcgctgggagacgggaaaaaatccgcccaacacaaagaaaaacttcggctacctg
atgtggcgtaaacgtaactgtgtattcctgtaa

DBGET integrated database retrieval system