KEGG   Escherichia coli O17 K52 H18 UMN026 (ExPEC): p1ECUMN_0108
Entry
p1ECUMN_0108      CDS       T00831                                 

Gene name
traK
Definition
(RefSeq) conjugal transfer protein TraK
  KO
K12066  conjugal transfer pilus assembly protein TraK
Organism
eum  Escherichia coli O17:K52:H18 UMN026 (ExPEC)
Brite
KEGG Orthology (KO) [BR:eum00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:eum02044]
    p1ECUMN_0108 (traK)
Secretion system [BR:eum02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   p1ECUMN_0108 (traK)
SSDB
Motif
Pfam: TraK
Other DBs
NCBI-GeneID: 7144252
NCBI-ProteinID: YP_002406005
UniProt: B7LJ55
Position
p1ESCUM:complement(86232..86960)
AA seq 242 aa
MRKNNTAIIFGSLFFSCSVMAANGTLAPTVVPMVNGGQASIAISNTSPNLFTVPGDRIIA
VNSLDGALTNNEQTASGGVVVATVNKKPFTFILETERGLNLSIQAVPREGAGRTIQLVSD
LRGTGEEAGAWETSTPYESLLVTISQAVRGGKLPAGWYQVPVTKETLQAPAGLSSVADAV
WTGNHLKMVRFAVENKTLSALNIRESDFWQPGTRAVMFSQPASQLLAGARMDVYVIRDGE
GN
NT seq 729 nt   +upstreamnt  +downstreamnt
atgagaaaaaataatacggcaataatatttggcagcctgtttttttcctgcagcgtgatg
gccgcaaacggtacgctggcccccaccgtggtgccaatggtgaacggtggtcaggccagt
attgccatcagcaataccagcccgaatctgtttaccgttcccggtgaccggattatcgcc
gtgaacagtctggatggtgccctgaccaataatgagcagaccgcctccggcggtgtggtg
gtggccaccgtcaacaaaaagccctttacgttcattctggaaacagagcgtggtctgaac
ctttccattcaggccgttccccgtgaaggcgcggggcgtaccattcagctggtcagtgac
ctgcgcggaaccggagaagaagccggagcgtgggaaacgtccacgccttacgaatccctg
cttgtgaccatcagccaggccgtccgtggcggaaaattacccgcaggctggtatcaggtc
ccggtgacaaaggaaaccctgcaggccccggcggggctgtcttcagtggcagatgccgta
tggacggggaatcacctgaagatggtccgctttgccgtggaaaataaaacgctgtctgcc
ctgaatatccgggaaagtgacttctggcagccgggaacccgtgccgtgatgttcagccag
cctgccagccagttactggcaggtgcgcgcatggatgtgtatgtcatccgtgacggggag
ggcaactga

DBGET integrated database retrieval system