KEGG   Escherichia coli O17 K52 H18 UMN026 (ExPEC): p2ECUMN_0026Help
Entry
p2ECUMN_0026      CDS       T00831                                 

Definition
(RefSeq) Putative pilx8 protein
  KO
K03203  type IV secretion system protein VirB8
Organism
eum  Escherichia coli O17:K52:H18 UMN026 (ExPEC)
Pathway
eum03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:eum00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    p2ECUMN_0026
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:eum02044]
    p2ECUMN_0026
Secretion system [BR:eum02044]
 Type IV secretion system
  Conjugal DNA-protein transfer (VirB/D) protein
   p2ECUMN_0026
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: VirB8
Motif
Other DBs
NCBI-GeneID: 7169422
NCBI-ProteinID: YP_002381208
UniProt: B7LJC6
Position
p2ESCUM:complement(18271..18984)
Genome map
AA seq 237 aa AA seqDB search
MEFKLPGFKNKKDVTDSSVSFEEKNIALQERMNRIYKFGGIGGMLIGGLSLLALNAALPL
KTTVVDAYLIDKVTGVAERLTSVKKENLSENEAIARYFITQYIKHREGYNFFSLQHDYDY
VMAYSAENVAADYNALFNSEQAPKLVYNKAEKTAMVQDNPSVIISPSSRTDDKDIGAYIR
FRLTIRDVATGQTRQEFWNVRLTYRIEPQVEMVSGERNNNPLKFVVTSYVRDKEARG
NT seq 714 nt NT seq  +upstreamnt  +downstreamnt
atggaatttaaacttcccggatttaaaaataaaaaagacgttactgactcatcagtttcg
tttgaagaaaaaaacattgcactacaggagagaatgaatcgtatttataaattcggtggt
atcggaggcatgttaattggtgggctgtctttacttgcattaaatgcagcattaccactg
aaaacaacagttgttgatgcctaccttatcgataaggttacaggtgtggctgaacgtctg
acttctgttaaaaaagaaaatctttctgaaaacgaagccattgcccgatattttatcacc
cagtatataaaacatcgtgaaggttataattttttcagtctccagcatgattatgattat
gtaatggcttacagcgcggagaatgtcgcggcagattataacgcattatttaacagtgaa
caggcaccaaaacttgtttataacaaagcagaaaaaacggcaatggttcaggataatcca
tctgtcataatttcaccttcgtcacggacggatgataaagatatcggtgcgtatattcgt
tttcgtctgaccatcagggatgttgctaccggacaaacccgccaggagttctggaatgtt
cgcctgacttatcgtatcgaaccgcaggttgaaatggtgtcaggggaacgtaataacaat
cctcttaagttcgttgtaacaagctacgttcgcgataaagaagccagaggttaa

DBGET integrated database retrieval system