KEGG   Escherichia coli UMNK88 (ETEC, porcine): UMNK88_158Help
Entry
UMNK88_158        CDS       T02001                                 

Gene name
hemL
Definition
(GenBank) glutamate-1-semialdehyde-2,1-aminomutase HemL
  KO
K01845  glutamate-1-semialdehyde 2,1-aminomutase [EC:5.4.3.8]
Organism
eun  Escherichia coli UMNK88 (ETEC, porcine)
Pathway
eun00860  Porphyrin and chlorophyll metabolism
eun01100  Metabolic pathways
eun01110  Biosynthesis of secondary metabolites
eun01120  Microbial metabolism in diverse environments
Module
eun_M00121  Heme biosynthesis, plants and bacteria, glutamate => heme
eun_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:eun00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    UMNK88_158 (hemL)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:eun01007]
    UMNK88_158 (hemL)
Enzymes [BR:eun01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.8  glutamate-1-semialdehyde 2,1-aminomutase
     UMNK88_158 (hemL)
Amino acid related enzymes [BR:eun01007]
 Aminotransferase (transaminase)
  Class III
   UMNK88_158 (hemL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3
Motif
Other DBs
NCBI-ProteinID: AEE54821
UniProt: A0A0E0TTG0
Position
complement(176429..177709)
Genome map
AA seq 426 aa AA seqDB search
MSKSENLYSAARELIPGGVNSPVRAFTGVGGTPLFIEKADGAYLYDVDGKAYIDYVGSWG
PMVLGHNHPAIRNAVIEAAERGLSFGAPTEMEVKMAQLVTELVPTMDMVRMVNSGTEATM
SAIRLARGFTGRDKIIKFEGCYHGHADCLLVKAGSGALTLGQPNSPGVPADFAKHTLTCT
YNDLASVRAAFEQYPQEIACIIVEPVAGNMNCVPPLPDFLPGLRALCDEFGALLIIDEVM
TGFRVALAGAQDYYGVVPDLTCLGKIIGGGMPVGAFGGRRDVMDALAPTGPVYQAGTLSG
NPIAMAAGFACLNEVAQPGVHETLDELTTRLAEGLLEAAEEAGIPLVVNHVGGMFGIFFT
DAESVTCYQDVMACDVERFKRFFHMMLDEGVYLAPSAFEAGFMSVAHSMEDINNTIDAAR
RVFAKL
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgagtaagtctgaaaatctttacagcgcagcgcgcgagctgatccctggcggtgtgaac
tcccctgttcgcgcctttactggcgtgggcggcactccactgtttatcgaaaaagcggac
ggcgcttatctgtacgatgttgatggcaaagcctatatcgattatgtcggttcctggggg
ccgatggtgctgggccataaccatccggcaatccgcaatgccgtgattgaagccgccgag
cgtggtttaagctttggtgcaccaaccgaaatggaagtgaaaatggcgcaactggtgacc
gaactggtcccgaccatggatatggtgcgcatggtgaactccggcaccgaggcgacgatg
agcgccatccgtctggcccgtggttttaccggtcgcgacaaaattattaaatttgaagga
tgctaccacggtcacgctgactgcctgctggtgaaagccggttctggcgcactcacgtta
ggtcagccaaactcgccgggcgttccggcagatttcgccaaacataccttaacctgtact
tataacgatctggcttctgtacgcgccgcatttgagcaatacccgcaagagattgcctgt
attatcgtcgagccggtggcaggcaatatgaactgtgttccaccgctgccagacttcctg
ccaggtctgcgcgcgctgtgcgacgaatttggcgcgttgctgatcatcgatgaagtgatg
accggtttccgcgtagcgctagctggcgcacaggattattacggcgtagtgccagattta
acctgcctcggcaaaatcatcggcggtggaatgccggtaggcgcattcggtggtcgtcgt
gatgtaatggatgcgctggccccgacgggtccggtctatcaggcgggtacgctttccggt
aacccgattgcgatggcagcgggtttcgcctgtctgaatgaagtcgcgcagccgggcgtt
cacgaaacgctggatgagctgacaacacgtctggcagaaggtctgctggaagcggcagaa
gaagccggaattccgctggtcgttaaccacgttggcggcatgttcggtattttctttacc
gacgccgagtccgtgacgtgctatcaggatgtgatggcctgtgacgtggaacgctttaag
cgtttcttccatatgatgctggacgaaggtgtttacctggcaccgtcagcgtttgaagcg
ggctttatgtccgtggcgcacagcatggaagatatcaataacaccatcgatgctgcacgt
cgggtgtttgcgaagttgtga

DBGET integrated database retrieval system