KEGG   Escherichia coli UMNK88: UMNK88_1592Help
Entry
UMNK88_1592       CDS       T02001                                 

Definition
(GenBank) bifunctional indole-3-glycerol phosphate synthase/phosphoribosylanthranilate isomerase TrpC
  KO
K13498  indole-3-glycerol phosphate synthase / phosphoribosylanthranilate isomerase [EC:4.1.1.48 5.3.1.24]
Organism
eun  Escherichia coli UMNK88
Pathway
eun00400  Phenylalanine, tyrosine and tryptophan biosynthesis
eun01100  Metabolic pathways
eun01110  Biosynthesis of secondary metabolites
eun01130  Biosynthesis of antibiotics
eun01230  Biosynthesis of amino acids
Module
eun_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:eun00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    UMNK88_1592
Enzymes [BR:eun01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     UMNK88_1592
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.24  phosphoribosylanthranilate isomerase
     UMNK88_1592
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS PRAI QRPTase_C
Motif
Other DBs
NCBI-ProteinID: AEE56189
UniProt: A0A0E0TYK4
Structure
PDB: 

Position
complement(1536151..1537509)
Genome map
AA seq 452 aa AA seqDB search
MQTVLAKIVADKAIWVETRKQQQPLASFQNEVQPSTRHFYDALQGARTAFILECKKASPS
KGVIRDDFDPARIAAIYKHYASAISVLTDEKYFQGSFDFLPIVSQIAPQPILCKDFIIDP
YQIYLARYYQADACLLMLSVLDDEQYRQLAAVAHSLEMGVLTEVSNEEELERAIALGAKV
VGINNRDLRDLSIDLNRTRELAPKLGHNVTVISESGINTYAQVRELSHFANGFLIGSALM
AHDDLHAAVRRVLLGENKVCGLTRGQDAKAAYDAGAIYGGLIFVATSPRCVNVEQAQEVM
AAAPLQYVGVFRNHDIADVVDKAKVLSLAAVQLHGNEEQLYIDTLREALPAHVAIWKALS
VGETLPAREFQHVDKYVLDNGQGGSGQRFDWSLLNGQSLGNVLLAGGLGADNCVEAAQTG
CAGLDFNSAVESQPGIKDARLLASVFQTLRAY
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaccgttttagcgaaaatcgtcgcagacaaggcgatttgggtagaaacccgcaaa
cagcagcaaccgctggccagttttcagaatgaggttcagccgagcacgcgacatttttat
gatgcgctacagggtgcgcgcacggcgtttattctggagtgcaagaaagcgtcgccgtca
aaaggcgtgatccgtgatgatttcgatccagcacgcattgccgccatttataaacattac
gcttcggcaatttcggtgctgactgatgagaaatattttcaggggagctttgatttcctc
cccatcgtcagccaaatcgccccgcagccgattttatgtaaagacttcattatcgatcct
taccagatctatctggcgcgctattaccaggctgatgcctgcttattaatgctttcagta
ctggatgacgaacaatatcgccagcttgccgccgtcgcccacagtctggagatgggtgtg
ctgaccgaagtcagtaatgaagaggaactggagcgtgccattgcattgggggcaaaggtc
gttggcatcaacaaccgcgatctgcgtgatttgtcgattgatctcaaccgtacccgcgag
cttgcgccgaaactggggcacaacgtgacggtaatcagcgaatccggcatcaatacttac
gctcaggtgcgcgagttaagccacttcgctaacggttttctgattggttcggcgttgatg
gcccatgacgatttgcacgccgccgtgcgccgggtgttgctgggtgagaataaagtatgt
ggcctgacgcgtgggcaagatgctaaagcagcttatgacgcgggcgcgatttacggtggg
ttgatttttgttgcgacatcaccgcgttgcgtcaacgttgaacaggcgcaggaagtgatg
gctgcggcaccgttgcagtatgttggcgtgttccgcaatcacgatattgccgatgtggtg
gacaaagctaaggtgttatcgctggcggcagtgcaactgcatggtaatgaagaacagctg
tatatcgatacgctgcgtgaagctctgccagcacatgttgccatctggaaagcattaagc
gtcggtgaaaccctgcccgcccgcgagtttcagcacgttgataaatatgttttagacaac
ggccagggtggaagcgggcaacgttttgactggtcactattaaatggtcaatcgcttggc
aacgttctgctggcggggggcttaggcgcagataactgcgtggaagcggcacaaaccggc
tgcgccggacttgattttaattctgctgtagagtcgcaaccgggcatcaaagacgcacgt
cttttggcctcggttttccagacgctgcgcgcatattaa

DBGET integrated database retrieval system