KEGG   Escherichia coli UMNK88 (ETEC, porcine): UMNK88_232Help
Entry
UMNK88_232        CDS       T02001                                 

Gene name
clpB
Definition
(GenBank) ATP-dependent chaperone protein ClpB
  KO
K11907  type VI secretion system protein VasG
Organism
eun  Escherichia coli UMNK88 (ETEC, porcine)
Pathway
eun03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:eun00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    UMNK88_232 (clpB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:eun02044]
    UMNK88_232 (clpB)
Secretion system [BR:eun02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   UMNK88_232 (clpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_2 AAA_lid_9 AAA AAA_5 AAA_16 ClpB_D2-small AAA_22 AAA_7 NACHT RsgA_GTPase TniB AAA_18 Sigma54_activat Rad17 AAA_6 ABC_tran_CTD
Motif
Other DBs
NCBI-ProteinID: AEE54886
UniProt: A0A0E0TTM5
Position
complement(250097..252862)
Genome map
AA seq 921 aa AA seqDB search
MIQIDLPPLVKRLNLFSRQALEMAASECMSQQAAEITVSHVLIQMLAMPRSDLRVITRQG
DIGMEELRQALTVENYTTARSADSYPAFSPMLVEWLKEGWLLASAEMQHSELRGGVLLLA
LLHSPLRYIPPAAARLLTGINRDRLQQDFVQWTQESAESVVPDADGKGAGTMTDASDTLL
ARYAKNMTADARNGRLDPVLCRDHEIDLMIDILCRRRKNNPVVVGEAGVGKSALIEGLAL
RIVAGQVPDKLKNTDIMTLDLGALQAGTSVKGEFEKRFKGLMAEVISSPVPVILFIDEAH
TLIGAGNQQGGLDISNLLKPALARGELKTIAATTWSEYKKYFEKDAALSRRFQLVKVSEP
NAAEATIILRGLSAVYEQSHGVLIDDDALQAAATLSERYLSGRQLPDKAIDVLDTACARV
AINLSSPPKQISALTTLSHQQEAEIRQLERELRIGLRTDTSRMTEVLVQYDETLTALDEL
EAAWHQQQTLVREIIALRQQLLGVAEDDAAPLPDADTVEDTQPESESEQDNTGAVPADEA
DREQPEETAETVSPVQRLAQLTAELDALHNDRLLVSPHVDKKQIAAVIAEWTGVPLNRLS
QNEMSVITDLTKWLGDTIKGQDLAIASLHKHLLTARADLRRPGRPLGAFLLAGPSGVGKT
ETVLQLAELLYGGRQYLTTINMSEFQEKHTVSRLIGSPPGYVGYGEGGVLTEAIRQKPYS
VVLLDEVEKAHPDVLNLFYQAFDKGEMADGEGRLIDCKNIVFFLTSNLGYQVIVEHADDP
ETMQEVLYPVLADFFKPALLARMEVVPYLPLSKETLATIIAGKLARLDNVLRSRFGAEVV
IEPEVTDEIMSRVTRAENGARMLESVIDGDMLPPLSLLLLQKMAANTAIARIRLSAVDGT
FTADVEDAQNDESVTKDETVL
NT seq 2766 nt NT seq  +upstreamnt  +downstreamnt
atgatccagattgatcttcccccgctggtaaaacggctgaacctgttctcccgccaggcg
ctggagatggccgcctctgaatgtatgagtcagcaggcagcggaaattaccgtcagccat
gtgctcattcagatgctcgccatgccacgcagtgacctgcgggttattacccgccagggc
gatattggcatggaagagttgcgccaggcgctgacggtagagaactacacaaccgcccgt
tctgcggacagctacccggcgttttccccgatgctggttgagtggcttaaagagggctgg
ctgctggcgtcggctgagatgcagcacagcgaactgcgcggcggcgtgttgctgctggcc
ctgctgcattcgccgctgcgttatataccgcctgctgccgcccggctgttgaccggcatt
aaccgtgaccgtctgcaacaggactttgtgcagtggacacaggagtcggcggaatcagtc
gtgccggatgcagacggtaaaggcgcaggcacaatgacggacgcctctgacaccctgctt
gcccgctatgccaaaaacatgaccgcagacgcccgtaacggcaggcttgacccggtactg
tgccgcgaccacgaaatcgacctgatgatcgacattctctgccgccgccgtaaaaacaac
ccggtggtggtgggcgaagcgggcgtgggcaaaagcgcactgattgaagggctggcgctg
cgcatcgtggcaggccaggtgccggacaagctgaaaaacaccgatatcatgacccttgac
ttgggcgcattgcaggccgggacgtcggtgaagggtgaattcgaaaaacgtttcaaaggg
ctgatggcggaggtcatttcctccccggtgccggtcattctgtttatcgacgaagcacat
accctgattggcgcgggcaaccagcagggcgggctggatatctccaacctgctcaaaccg
gcgctggcgcgcggcgagctgaaaaccatcgccgccaccacctggagcgagtacaaaaaa
tacttcgaaaaagatgccgccctgtcgcgccgcttccagttggtgaaggtcagcgaaccc
aacgctgccgaagccaccattattctgcgcggtctgtcggcggtctatgaacagtctcac
ggcgtgctgattgatgatgacgccttgcaggccgctgcgacattaagcgagcgttatctc
tccgggcgtcagttaccggacaaagcgattgatgtgctggataccgcctgcgcccgtgtg
gccatcaacctgtcgtcgccgccgaagcaaatctcggcgctgaccactctgagccaccag
caggaggcggaaattcgccagcttgagcgcgagcttcgcatcggactgcgtaccgacaca
tcacggatgacagaggtgctggtgcagtatgatgaaacgctgacggcgctggatgaactg
gaagcggcctggcaccagcagcagacgctggtccgggagattatcgcgctgcgccagcag
ttactgggcgtggcagaggacgatgcggcgccgttgccggacgcagataccgtggaggat
acgcagccagagtcagagtcagaacaggataataccggtgccgtaccggctgatgaggcc
gacagagaacaaccggaagagaccgctgaaacagtttccccggtacagcggctggcccag
ctcactgccgaactggacgccctgcataacgaccggttgctggtctccccgcacgtcgat
aaaaaacagattgcggcggtgattgccgaatggaccggcgtgccgctcaaccgcctgtcg
cagaatgaaatgtcggtcatcaccgacctgacgaaatggctgggtgacaccatcaaaggc
caggacctggcgattgccagcctgcataagcatctactgaccgcacgcgccgacctgcgt
cgtccgggacgcccgctcggtgcgttcctgctggctggccccagcggtgtgggtaaaacc
gaaaccgtcctgcaactggcagagctgctctacggcggtcgccagtacctgaccaccatc
aatatgtccgaattccaggagaaacacaccgtctcgcggctgattggttcgcctccgggc
tacgttggctacggtgaaggcggcgtactgaccgaagcgattcgtcagaaaccctactcg
gtagtactgctcgatgaagtggaaaaagcgcacccggatgtgctcaacctgttctaccag
gcgttcgataagggcgaaatggcagacggtgaaggccgcctgattgactgcaaaaatatc
gtcttcttcctgacgtccaacctcggctaccaggtaatagtcgagcatgccgatgacccg
gaaaccatgcaggaagtactgtatccggtgctggccgacttcttcaaacctgccctgctg
gcgcgtatggaagtggtgccgtatctgccgctgtcgaaagagacgctcgccaccattatc
gccggaaaactggcccgtctggataacgtgctgcgcagtcgctttggtgcagaagtggtc
attgaaccggaagtgacggacgaaatcatgagccgcgtcacccgcgcggaaaacggcgcg
aggatgctggaatcggtcatcgatggcgacatgctaccgccgctctcgctgctgctgttg
cagaaaatggcggctaacacggcgattgcccggattcggttgtcggcagtggacggcaca
tttacggcagacgtggaagatgctcagaacgacgagtccgtcacaaaggatgaaacggtt
ttatga

DBGET integrated database retrieval system