KEGG   Escherichia coli UMNK88 (ETEC, porcine): UMNK88_3560
Entry
UMNK88_3560       CDS       T02001                                 

Definition
(GenBank) carbon monoxide dehydrogenase, small chain
  KO
K13480  xanthine dehydrogenase iron-sulfur-binding subunit
Organism
eun  Escherichia coli UMNK88 (ETEC, porcine)
Pathway
eun00230  Purine metabolism
eun01100  Metabolic pathways
eun01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:eun00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    UMNK88_3560
SSDB
Motif
Pfam: Fer2_2 Fer2 Fer2_3
Other DBs
NCBI-ProteinID: AEE58097
UniProt: A0A0E0U3A3
Position
3437012..3437491
AA seq 159 aa
MNHSETITIECTINGMPFQLHAAPGTPLSELLREQGLLSVKQGCCVGECGACTVLVDGTA
IDSCLYLAAWAEGKEIRTLEGEAKGGKLSHVQQAYAKSGAVQCGFCTPGLIMATTAMLAK
PREKPLTITEIRRGLAGNLCRCTGYQMIVNTVLDCEKTK
NT seq 480 nt   +upstreamnt  +downstreamnt
atgaatcacagcgaaacaattaccatcgaatgcaccattaacgggatgccttttcagctt
cacgccgcaccaggcacgccgctctcggaattactccgcgaacaaggactgctaagtgtc
aaacaagggtgctgcgtgggtgaatgtggtgcctgtacggtgttggtcgacggcacagca
atagacagttgcttataccttgccgcctgggctgaaggaaaagagatccgcacgctggaa
ggtgaagcgaaaggcggaaaactttctcatgttcagcaggcttatgcgaaatccggcgca
gtgcagtgcgggttttgtacgcctggcctgattatggctaccacggcaatgctggcgaaa
ccacgcgagaagccattaaccattacggaaattcgtcgcggactggcgggaaatctttgt
cgctgcacggggtatcagatgattgtaaatacagttctggattgcgagaaaacgaagtaa

DBGET integrated database retrieval system