KEGG   Escherichia coli UMNK88 (ETEC, porcine): UMNK88_4134Help
Entry
UMNK88_4134       CDS       T02001                                 

Gene name
cobA
Definition
(GenBank) uroporphyrin-III C-methyltransferase CobA
  KO
K02302  uroporphyrin-III C-methyltransferase / precorrin-2 dehydrogenase / sirohydrochlorin ferrochelatase [EC:2.1.1.107 1.3.1.76 4.99.1.4]
Organism
eun  Escherichia coli UMNK88 (ETEC, porcine)
Pathway
eun00860  Porphyrin and chlorophyll metabolism
eun01100  Metabolic pathways
eun01110  Biosynthesis of secondary metabolites
eun01120  Microbial metabolism in diverse environments
Module
eun_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:eun00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    UMNK88_4134 (cobA)
Enzymes [BR:eun01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.76  precorrin-2 dehydrogenase
     UMNK88_4134 (cobA)
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.107  uroporphyrinogen-III C-methyltransferase
     UMNK88_4134 (cobA)
 4. Lyases
  4.99  Other lyases
   4.99.1  Sole sub-subclass for lyases that do not belong in the other subclasses
    4.99.1.4  sirohydrochlorin ferrochelatase
     UMNK88_4134 (cobA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TP_methylase NAD_binding_7 CysG_dimeriser Sirohm_synth_M Radical_SAM
Motif
Other DBs
NCBI-ProteinID: AEE58653
UniProt: A0A0E0U456
Position
3985223..3986596
Genome map
AA seq 457 aa AA seqDB search
MDHLPIFCQLRDRDCLIVGGGDVAERKARLLLDAGARLTVNALAFIPQFTAWADAGMLTL
VEGPFDESLLDTCWLAIAATDDDALNQRVSEAAEARRIFCNVVDAPKAASFIMPSIIDRS
PLMVAVSSGGTSPVLARLLREKLESLLPLHLGQVAKYAGQLRGRVKQQFATMGERRRFWE
KLFVNDRLAQSLANNDQKAITETTEQLINEPLDHRGEVVLVGAGPGDAGLLTLKGLQQIQ
QADVVVYDRLVSDDIMNLVRRDADRVFVGKRAGYHCVPQEEINQILLREAQKGKRVVRLK
GGDPFIFGRGGEELETLCNAGIPFSVVPGITAASGCSAYSGIPLTHRDYAQSVRLITGHL
KTGGELDWENLAAEKQTLVFYMGLNQAATIQQKLIEHGMPGEMPVAIVENGTAVTQRVID
GTLTQLGELAQQMNSPSLIIIGRVVGLRDKLNWFSNH
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
gtggatcatttgcctatattttgccaattacgcgatcgcgactgtctgattgtcggcggt
ggtgatgtcgcggaacgcaaagcaaggttgctgttagacgcaggcgctcgcttaacggtg
aatgcattagcgtttattccacagttcaccgcatgggcagatgcaggcatgttaaccctc
gtcgaagggccatttgatgaaagccttctcgacacctgctggctggcgattgcagcgacg
gatgatgacgcgcttaaccagcgcgtcagcgaagccgctgaagctcgtcgcatcttctgt
aacgtagtcgatgcgccgaaagccgccagctttattatgccgtcgattattgaccgctca
ccgctcatggtcgcggtctcctctggcggcacctctccggttctggcacgcctgttgcgc
gaaaaactcgaatcactgctgccgttgcatctgggccaggtagcgaaatacgccgggcaa
ttacgcgggcgagtgaaacaacagttcgccacgatgggtgagcgtcgccgtttctgggag
aaattgttcgttaacgatcgcctggcgcagtcgctggcaaacaacgatcagaaagccatt
actgaaaccaccgaacagttaatcaacgaaccgcttgaccatcgcggtgaagtggtgctg
gttggtgcaggtccgggcgatgccgggctgctgacgctgaaaggactgcaacaaattcag
caggcagatgtggtggtctacgaccgtctggtttctgacgatattatgaatctggtacgc
cgcgatgctgatcgcgttttcgtcggcaaacgcgcgggataccactgtgtaccgcaggaa
gagattaaccagatcctgctgcgggaagcgcaaaaaggcaaacgcgtggtgcggctgaaa
ggtggcgatccgtttatttttggccgtggtggcgaagagctggaaacactgtgcaacgcg
ggtattccgttctcggtggttccgggtattaccgcagcttctggttgctctgcctattcg
ggtattccactcacgcatcgcgattatgcccagagcgtacgcttaattaccggacactta
aaaaccggtggcgagctggactgggaaaacctggcggcagaaaaacagacgctggtgttc
tatatggggttgaatcaggccgcgactattcagcaaaagctgattgaacacggtatgcct
ggcgaaatgccggtggcaattgtcgaaaacggaacggcagtcacgcagcgcgtgattgac
ggtacgctcacgcaactcggtgaacttgctcagcaaatgaacagtccatcgctaattatt
attggtcgggttgttggcctgcgcgataaactgaactggttctccaaccattaa

DBGET integrated database retrieval system