KEGG   Escherichia coli UMNK88 (ETEC, porcine): UMNK88_4386Help
Entry
UMNK88_4386       CDS       T02001                                 

Definition
(GenBank) mannitol-1-phosphate 5-dehydrogenase
  KO
K00009  mannitol-1-phosphate 5-dehydrogenase [EC:1.1.1.17]
Organism
eun  Escherichia coli UMNK88 (ETEC, porcine)
Pathway
eun00051  Fructose and mannose metabolism
eun01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eun00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    UMNK88_4386
Enzymes [BR:eun01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.17  mannitol-1-phosphate 5-dehydrogenase
     UMNK88_4386
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mannitol_dh_C Mannitol_dh 3HCDH_N AfaD
Motif
Other DBs
NCBI-ProteinID: AEE58904
UniProt: A0A0E0U695
Position
4264371..4265519
Genome map
AA seq 382 aa AA seqDB search
MKALHFGAGNIGRGFIGKLLADAGIQLTFADVNQVVLDALNARHSYQVHVVGETEQVDTV
SGVNAVSSIGDDVVDLIAQVDLVTTAVGPVVLERIAPAIAKGLVKRKEQGNESPLNIIAC
ENMVRGTTQLKGHVMNALPEDAKAWVEEHVGFVDSAVDRIVPPSASATNDPLEVTVETFS
EWIVDKTQFKGALPNIPGMELTDNLMAFVERKLFTLNTGHAITAYLGKLAGHQTIRDAIL
DEKIRAVVKGAMEESGAVLIKRYGFDADKHAAYIQKILGRFENPYLKDDVERVGRQPLRK
LSAGDRLIKPLLGTLEYGLPHKNLIEGIAAAMHFRSEDDPQAQELAALIADKGPQAALAQ
ISGLDANSEVVSEAVTAYKAMQ
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcattacattttggcgcaggtaatatcggtcgtggctttatcggtaaactgctg
gcagacgcgggtatccaactgacgtttgccgatgtcaatcaggtggtacttgatgccctg
aatgcccgtcatagctatcaggtacatgtggttggtgaaaccgagcaggtagataccgtt
tccggcgtcaatgctgtcagcagcattggtgatgatgtcgttgatctgattgctcaggtt
gatttagtcactaccgccgttggcccggttgtgctggaacgtattgctccggcaatcgcc
aaagggctggtgaaacgtaaagaacaaggtaatgaatccccgctgaacatcatcgcctgt
gaaaacatggtacgcggtaccacgcagctgaaaggccatgtgatgaacgccctgccggaa
gacgccaaagcgtgggtagaagaacacgttggctttgtcgattccgccgttgaccgcatc
gtaccgccttcggcttcggcaactaacgatccgctggaagtgacggtagaaaccttcagc
gaatggattgtcgataaaacgcagttcaaaggcgcactgccgaacatcccaggcatggag
ttaaccgacaacctgatggcatttgtcgaacgtaaactcttcaccctgaacacgggtcat
gctataaccgcgtacctcggaaaactggccggtcatcagaccattcgtgacgcgattctc
gacgagaaaatccgcgcggtggtaaaaggtgcgatggaagaaagtggtgcagtattgatc
aagcgctacggctttgacgctgacaagcatgcggcgtacatccagaaaattctcggccgt
tttgagaacccgtatctgaaagatgatgtagagcgcgtaggccgtcagccactgcgtaaa
ctgagtgctggcgaccgtctgatcaagccactgctcggtacgctggaatatggtctgcca
cataaaaacctgattgaaggtattgccgctgcaatgcacttccgcagtgaagatgatccg
caggctcaggaactggcagcactgatcgctgacaaaggtccgcaggcggcgctggcacag
atttccggtcttgatgccaacagcgaggttgtatccgaggcggtaaccgcttataaagca
atgcaataa

DBGET integrated database retrieval system