KEGG   Escherichia coli UMNK88: UMNK88_5301Help
Entry
UMNK88_5301       CDS       T02001                                 

Gene name
deoA
Definition
(GenBank) thymidine phosphorylase DeoA
  KO
K00758  thymidine phosphorylase [EC:2.4.2.4]
Organism
eun  Escherichia coli UMNK88
Pathway
eun00240  Pyrimidine metabolism
eun01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eun00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    UMNK88_5301 (deoA)
Enzymes [BR:eun01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     UMNK88_5301 (deoA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_3 PYNP_C Glycos_trans_3N
Motif
Other DBs
NCBI-ProteinID: AEE59764
UniProt: A0A0E0U8N4
Structure
PDB: 

Position
5164092..5165414
Genome map
AA seq 440 aa AA seqDB search
MFLAQEIIRKKRDGHALSDEEIRFFINGIRDNTISEGQIAALAMTIFFHDMTMPERVSLT
MAMRDSGTVLDWKSLHLNGPIVDKHSTGGVGDVTSLMLGPMVAACGGYIPMISGRGLGHT
GGTLDKLESIPGFDIFPDDNRFREIIKDVGVAIIGQTSSLAPADKRFYATRDITATVDSI
PLITASILAKKLAEGLDALVMDVKVGSGAFMPTYELSEALAEAIVGVANGAGVRTTALLT
DMNQVLASSAGNAVEVREAVQFLTGEYRNPRLFDVTMALCVEMLISGKLAKDDAEARAKL
QAVLDNGKAAEVFGRMVAAQKGPTDFVENYAKYLPTAMLTKAVYADTEGFVSEMDTRALG
MAVVAMGGGRRQASDTIDYSVGFTDMARLGDQVDGQRPLAVIHAKDENSWQEAAKAVKAA
IKLADKAPESTPTVYRRISE
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
ttgtttctcgcacaagaaattattcgtaaaaaacgtgatggtcatgcgctaagcgatgaa
gaaattcgtttctttatcaacggtattcgcgacaacactatctccgaagggcagattgcc
gccctcgcgatgaccattttcttccacgatatgacaatgcctgagcgtgtctcgctgacc
atggcgatgcgagattcaggaaccgttctcgactggaaaagcctgcatctgaatggcccg
attgttgataaacactccaccggcggcgtcggcgatgtgacttcgctgatgttggggccg
atggtcgcagcctgcggcggctatattccgatgatctctggtcgcggcctcggtcatact
ggcggtacgctcgacaaactggaatccatccctggcttcgacattttcccggatgacaac
cgtttccgcgaaattattaaagacgtcggcgtggcgattatcggccagaccagctcactg
gctccggcagataaacgtttctacgcgacccgcgatattaccgcaaccgtggactccatc
ccgctgatcactgcctcgatcctggcgaagaaactggcggaaggtctggatgcgctggtg
atggacgtgaaagtgggtagcggcgcgtttatgccgacctacgaactctctgaagccctt
gccgaagcgattgttggcgtggctaacggcgctggcgtgcgcaccaccgcgctgctcacc
gacatgaatcaggtactggcctccagtgcaggtaacgcggttgaagttcgtgaagcggtg
cagttcctgacgggtgaatatcgtaacccgcgtctgtttgatgtcacgatggcgctgtgc
gtggagatgctgatctccggcaaactggcgaaagatgacgccgaagcgcgcgcgaaattg
caggcggtgctggacaacggtaaagcggcagaagtctttggtcgtatggtagcggcacaa
aaaggcccgaccgacttcgttgagaactacgcgaagtatctgccgacagcgatgctgacg
aaagcagtctatgctgataccgaaggttttgtcagtgaaatggatacccgcgcgctgggg
atggcagtggttgcaatgggcggcggtcgtcgtcaggcatctgacaccattgattacagc
gtcggctttactgatatggcgcgtttgggcgaccaggtagacggtcagcgtccgctggcg
gttatccacgcgaaagacgaaaacagctggcaggaagcggcgaaagcggtgaaagcggca
attaaacttgccgataaagcaccggaaagcacaccaactgtctatcgccgtatcagcgaa
taa

DBGET integrated database retrieval system