KEGG   Escherichia coli UMNK88 (ETEC, porcine): UMNK88_964Help
Entry
UMNK88_964        CDS       T02001                                 

Definition
(GenBank) N-acetylmuramoyl-L-alanine amidase AmiD
  KO
K11066  N-acetylmuramoyl-L-alanine amidase [EC:3.5.1.28]
Organism
eun  Escherichia coli UMNK88 (ETEC, porcine)
Brite
KEGG Orthology (KO) [BR:eun00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:eun01011]
    UMNK88_964
Enzymes [BR:eun01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.28  N-acetylmuramoyl-L-alanine amidase
     UMNK88_964
Peptidoglycan biosynthesis and degradation proteins [BR:eun01011]
 Peptidoglycan biosynthesis and degradation
  Amidase
   UMNK88_964
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase_2
Motif
Other DBs
NCBI-ProteinID: AEE55589
UniProt: A0A0E0TWV0
Structure
PDB: 

Position
967314..968144
Genome map
AA seq 276 aa AA seqDB search
MRRVFWLVAAALLLAGCAGEKGIVEKEGYQLDTRRQAQAAYPRIKVLVIHYTADDFDSSL
ATLTDKQVSSHYLVPAVPPRYNGKPRIWQLVPEQELAWHAGISAWRGATRLNDTSIGIEL
ENRGWQKSAGVKYFAPFEPAQIQALIPLAKDIIARYHIKPENVVAHADIAPQRKDDPGPL
FPWQQLAQQGIGAWPDAQRVNFYLAGRAPHTPVDTTSLLELLARYGYDVKPDMIPREQRR
VIMAFQMHFRPTLYNGEADAETQAIAEALLEKYGQD
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atgagaagagtcttctggctggtcgctgccgctctgttattggcagggtgtgcaggcgaa
aaaggcattgtcgagaaagagggatatcagcttgatacccgacgccaggcgcaggcggcg
tatccgcgcattaaagtgctggtgatccactacaccgcagatgattttgatagctcgctg
gcgacactgaccgataagcaggtcagctcgcattatctggtccctgcggtaccaccgcga
tacaacggtaaaccgcgcatctggcaactggtgccggaacaagaactggcctggcatgcg
gggattagcgcctggcgcggggcaacgcgccttaacgacacctctattggcattgagctg
gaaaaccgtggctggcaaaaatcggccggagtgaaatattttgccccgtttgaaccggca
cagattcaggcgcttattccactggcgaaagatattattgcccgttatcacatcaagccg
gaaaacgtagtggcacatgcggatatcgcaccgcagcgcaaagacgatccggggccatta
tttccctggcagcaactggcgcagcaggggattggtgcctggccggatgcgcagcgggtt
aacttttaccttgccgggcgcgcgccgcacactcctgtagatactacgtcattgctggag
cttttggcgcgctacggttatgacgttaaacctgatatgataccgcgcgagcagcggcgc
gtgattatggcattccagatgcatttccgcccgacgttatataacggcgaagcggatgca
gaaactcaggcgattgccgaagcattgctggagaaatacgggcaggattag

DBGET integrated database retrieval system