KEGG   Escherichia coli UMNK88 (ETEC, porcine): UMNK88_pEnt35Help
Entry
UMNK88_pEnt35     CDS       T02001                                 

Gene name
eltA
Definition
(GenBank) heal labile enterotoxin subunit LT-A
  KO
K10928  cholera enterotoxin subunit A [EC:2.4.2.36]
Organism
eun  Escherichia coli UMNK88 (ETEC, porcine)
Module
eun_M00576  ETEC pathogenicity signature, heat-labile and heat-stable enterotoxins
Brite
KEGG Orthology (KO) [BR:eun00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02042 Bacterial toxins [BR:eun02042]
    UMNK88_pEnt35 (eltA)
Enzymes [BR:eun01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.36  NAD+---diphthamide ADP-ribosyltransferase
     UMNK88_pEnt35 (eltA)
Bacterial toxins [BR:eun02042]
 Type III toxins: Intracellular toxins
  ADP-ribosyltransferase
   Cholera toxin/Heat-labile enterotoxin
    UMNK88_pEnt35 (eltA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Enterotoxin_a
Motif
Other DBs
NCBI-ProteinID: AEE59980
UniProt: A0A0E0U864
Structure
PDB: 

Position
pUMNK88_Ent:19429..20259
Genome map
AA seq 276 aa AA seqDB search
MALSFSGLSSCMIYKFSSMKNITFIFFILLASPLYANGDRLYRADSRPPDEIKRSGGLMP
RGHNEYFDRGTQMNINLYDHARGTQTGFVRYDDGYVSTSLSLRSAHLAGQSILSGYSTYY
IYVIATAPNMFNVNDVLGVYSPHPYEQEVSALGGIPYSQIYGWYRVNFGVIDERLHRNRE
YRDRYYRNLNIAPAEDGYRLAGFPPDHQAWREEPWIHHAPQGCGNSSRTITGDTCNEETQ
NLSTIYLREYQSKVKRQIFSDYQSEVDIYNRIRDEL
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
gtggcgttatctttttccggattgtcttcttgtatgatatataagttttcctcgatgaaa
aatataactttcattttttttattttattagcatcgccattatatgcaaatggcgacaga
ttataccgtgctgactctagacccccagatgaaataaaacgttccggaggtcttatgccc
agagggcataatgagtacttcgatagaggaactcaaatgaatattaatctttatgatcac
gcgagaggaacacaaaccggctttgtcagatatgatgacggatatgtttccacttctctt
agtttgagaagtgctcacttagcaggacagtctatattatcaggatattccacttactat
atatatgttatagcgacagcaccaaatatgtttaatgttaatgatgtattaggcgtatac
agccctcacccatatgaacaggaggtttctgcgttaggtggaataccatattctcagata
tatggatggtatcgtgttaattttggtgtgattgatgaacgattacatcgtaacagggaa
tatagagaccggtattacagaaatctgaatatagctccggcagaggatggttacagatta
gcaggtttcccaccggatcaccaagcttggagagaagaaccctggattcatcatgcacca
caaggttgtggaaattcatcaagaacaatcacaggtgatacttgtaatgaggagacccag
aatctgagcacaatatatctcagggaatatcaatcaaaagttaagaggcagatattttca
gactatcagtcagaggttgacatatataacagaattcgggatgaattatga

DBGET integrated database retrieval system