KEGG   Eutrema salsugineum: EUTSA_v10001969mgHelp
Entry
EUTSA_v10001969mg CDS       T02985                                 

Definition
(RefSeq) hypothetical protein
  KO
K01593  aromatic-L-amino-acid/L-tryptophan decarboxylase [EC:4.1.1.28 4.1.1.105]
Organism
eus  Eutrema salsugineum
Pathway
eus00350  Tyrosine metabolism
eus00360  Phenylalanine metabolism
eus00380  Tryptophan metabolism
eus00901  Indole alkaloid biosynthesis
eus00950  Isoquinoline alkaloid biosynthesis
eus00965  Betalain biosynthesis
eus01100  Metabolic pathways
eus01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:eus00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    EUTSA_v10001969mg
   00360 Phenylalanine metabolism
    EUTSA_v10001969mg
   00380 Tryptophan metabolism
    EUTSA_v10001969mg
  09110 Biosynthesis of other secondary metabolites
   00901 Indole alkaloid biosynthesis
    EUTSA_v10001969mg
   00950 Isoquinoline alkaloid biosynthesis
    EUTSA_v10001969mg
   00965 Betalain biosynthesis
    EUTSA_v10001969mg
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:eus04147]
    EUTSA_v10001969mg
Enzymes [BR:eus01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.28  aromatic-L-amino-acid decarboxylase
     EUTSA_v10001969mg
    4.1.1.105  L-tryptophan decarboxylase
     EUTSA_v10001969mg
Exosome [BR:eus04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   EUTSA_v10001969mg
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase Aminotran_1_2 Aminotran_5
Motif
Other DBs
NCBI-GeneID: 18025556
NCBI-ProteinID: XP_006408952
UniProt: V4LIP4
Position
Unknown
AA seq 490 aa AA seqDB search
MENGNKNVLKPMDSEQLREYGHRMVDFIADYYKTIEDFPVLSQVQPGYLHNLLPDSAPDQ
PETLEEVLDDVKGKILPGVTHWQSPSFFAYYPSNSSVAGFLGEMLSAGLGIVGFSWITSP
AATELEMIVLDWLAKLLNLPEQFLSRGNGGGVIQGSASEAELVVLIAARDKVLRSVGKKA
LEKLVVYSSDQTHSALQKACQIAGIHPENCRVLKADYSTNYALRPETLQEAVSKDLEAGL
IPFFLCANVGTTSSTAVDPLAALGEIAKSNEMWFHVDAAYAGSACICPEYRQYIDGVETA
DSFNMNAHKWFLTNFDCSLLWVKDQYALTEARSTNPEFLKNKASQANLVVDYKDWQIPLG
RRFRSLKLWMVLRLYGSENLKSYIRNHIKLAKDFEQLVSEDPNFEIVTPRIFSLVCFRIV
PAENDEKKCNNQNRNLLDAVNSSGKLFLSHTALSGKIVLRCAIGAPLTEEKHVKEAWKVI
QEEASYLLRK
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atggaaaatggtaataagaacgtgttgaagccgatggactctgagcaactgagagagtac
ggacatcgaatggttgatttcattgccgactattacaaaaccatcgaagacttccctgtt
cttagccaagttcagcctggttatcttcataaccttctgcctgattccgcaccagaccaa
cctgaaacgcttgaagaagttcttgatgatgttaagggcaagatattgcccggagtaacg
cattggcaaagcccgagtttctttgcttattacccttctaacagtagcgttgctggtttc
ttgggtgagatgttgagtgctggtcttggaatcgttggttttagttggatcacttctcca
gctgccaccgagctcgaaatgattgttcttgattggcttgccaagctactcaacctaccc
gagcagtttctctccagagggaatggaggaggggtaatccaagggtcagctagtgaagct
gaacttgttgttctgattgctgcccgggacaaggttttaagaagcgttggcaagaaggcg
cttgagaagctcgttgtctactcctctgaccagacacattcagctttacagaaagcttgc
cagattgctggaatccatccagagaattgcagggtgctcaaagcagattactctacaaat
tacgctctgcgtcctgaaacgcttcaagaagctgtttctaaggatcttgaagctggattg
attccattcttcttatgtgctaatgttggaaccacttcttcaaccgcagttgatccatta
gctgcactgggagagatcgcaaagagcaatgagatgtggtttcacgtggatgcagcgtac
gctggaagtgcctgtatatgtccagagtatcgacaatacattgacggagtagaaactgca
gactcttttaacatgaatgctcacaaatggttcctcactaatttcgattgttcccttctt
tgggtcaaggatcagtatgctctcactgaagctcgttcaacaaatccagagtttctcaaa
aacaaggcctctcaggcaaacttggttgttgattacaaagattggcaaatccctctcgga
agaagatttagatcattgaagctatggatggttttacgactctatggatctgagaacttg
aagagctatataagaaaccatatcaaactggctaaagatttcgaacaacttgtgtctgaa
gatcccaactttgagattgtcactcctcggatcttttctctcgtctgtttccgcatcgtg
cctgcggaaaacgatgaaaagaagtgtaataaccaaaaccgcaacctcctagacgcagtg
aactcttcagggaaactcttcctttctcacactgctttgtcgggaaaaattgtactacgt
tgcgccataggagcgccattgacggaagagaagcacgtgaaggaggcatggaaggttatc
caggaagaagcatcatacttgcttcgcaagtaa

DBGET integrated database retrieval system