KEGG   Eutrema salsugineum: EUTSA_v10002208mgHelp
Entry
EUTSA_v10002208mg CDS       T02985                                 

Definition
(RefSeq) hypothetical protein
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
eus  Eutrema salsugineum
Pathway
eus00010  Glycolysis / Gluconeogenesis
eus00562  Inositol phosphate metabolism
eus01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eus00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EUTSA_v10002208mg
   00562 Inositol phosphate metabolism
    EUTSA_v10002208mg
Enzymes [BR:eus01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     EUTSA_v10002208mg
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     EUTSA_v10002208mg
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2
Motif
Other DBs
NCBI-GeneID: 18025457
NCBI-ProteinID: XP_006408719
UniProt: V4M5D5
Position
Unknown
AA seq 424 aa AA seqDB search
ARHGTRSPTKKRLREMENLAGRLKELVRDAEARDFPSDKIPGWLREWVSPWKGKVKGGEL
IRQGEDELYQLGIRVRDRFPTLFEEDYHPDVYTIRATQIPRASASAVAFGIGLFSEKGDL
GPGRNRAFAVTSENRASDTKLRFFECCQNYKSYRKAKEPDVDKLKEPVLNKIAASVAKRH
DLNFTKQDISSLWFLCKQEASLLNVTNQSCELFTPSEVALLEWADDLEVFILKGYGNSLN
YKMGFPLLEDVLHSMEEAIKAREENLPPGSYEKTRLRFAHAETIVPFSCLLGLFLDGSEF
EKIRKEKPLELPPQPPKTRDFRGSTMAPFGGNNMLVLYSCPAASSPKYFVQVLHNEHPIA
VPGCDGKDFCPLEDFKAKVVTPHLKRAFDSLCNANEDDPKQKPASSILALLSSWLFGSSH
KTEL
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
gctaggcatggaactcgatctcctaccaagaaacggttgcgggaaatggagaatttggct
ggtaggttgaaggaattggtaagagatgcagaagctagggattttccttcagacaaaatt
cccggatggttaagggaatgggtatctccttggaaaggaaaagtgaaaggaggagagctg
atcaggcaaggcgaggacgagttgtaccaacttggaatccgagttagggatcggtttcct
actttgtttgaagaggattaccaccctgatgtatatacaataagagctacgcagattcct
cgggcttctgctagtgctgtggcatttgggatagggttattcagtgagaaaggagatcta
ggaccaggccgtaatagagcattcgctgtcacaagcgagaaccgtgcaagtgatacgaag
ctgaggttttttgaatgttgtcaaaactacaagagctatagaaaagcaaaagagcctgat
gtggataagctcaaggaacctgtcttgaataagattgcagcttccgttgcaaagagacat
gatttgaatttcacaaaacaggatatttcttctctctggtttctgtgcaagcaggaagca
tcgttgcttaatgtaactaatcaaagttgtgaactgttcacgccatctgaggttgctttg
ttggaatgggcagatgacttggaagtgtttatcctgaaaggctatggaaattccttgaac
tacaaaatgggatttccattgctggaagatgttttgcattcaatggaagaagctatcaag
gcccgagaagaaaatctcccacctggaagctacgaaaaaacaagacttaggtttgcacat
gccgaaacaatagttcccttttcttgtcttctggggcttttccttgatggatctgagttt
gagaaaatacggaaggagaaaccattggaactccctcctcagcctcctaaaaccagggac
tttagaggcagcaccatggctccttttggtgggaacaacatgcttgtcctctacagttgt
cccgcagcttcctcgccgaagtactttgttcaggttctgcacaacgagcatcctatcgca
gtcccaggttgtgatggaaaagatttctgtcctctagaagatttcaaggccaaagtggtg
acccctcatctcaagcgtgcttttgacagtctctgcaatgctaatgaagatgacccgaaa
cagaagcctgcatcgagtatattagctttactgtcgagttggctgtttgggtcaagccat
aaaacggagctctaa

DBGET integrated database retrieval system