KEGG   Eutrema salsugineum: EUTSA_v100035630mHelp
Entry
EUTSA_v100035630m CDS       T02985                                 

Definition
(RefSeq) hypothetical protein
  KO
K12818  ATP-dependent RNA helicase DHX8/PRP22 [EC:3.6.4.13]
Organism
eus  Eutrema salsugineum
Pathway
eus03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:eus00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    EUTSA_v100035630m
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:eus03041]
    EUTSA_v100035630m
Enzymes [BR:eus01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     EUTSA_v100035630m
Spliceosome [BR:eus03041]
 Complex C
  Other components
   Step II factors
    EUTSA_v100035630m
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: OB_NTP_bind HA2
Motif
Other DBs
NCBI-GeneID: 18011940
NCBI-ProteinID: XP_006395547
UniProt: V4KZE3
Position
Unknown
AA seq 236 aa AA seqDB search
FPLEPPLSKMLLASVDLGCSDEILTMIAMIQTGNIFYRPREKQAQADQKRAKFFQPEGDH
LTLLAVYEAWKDKNFSGPWCFENFIQSRSLRRAQDVRKQLLSIMDKYKLDVVSAGKNFTK
IRKAITAGFFFHGARKDPQEGYRTLVENQPVYIHPSSALFQRQPDWVIYHDLVMTTKEYM
REVTVIDPKWLVELAPRFFKVADPTKMSKRKRQERIEPLYDRYHEPNSWRLSKRRA
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
tttcctcttgaacccccgctgtcaaaaatgttgctagcgagtgtggatctcgggtgcagc
gatgagattttaacgatgattgctatgatccagacgggcaacatattctatagaccgagg
gagaagcaagctcaggcagaccaaaaaagggcaaagtttttccagcccgaaggtgaccac
ttgacattgctagctgtatatgaagcttggaaggacaaaaacttttcaggtccatggtgt
ttcgaaaacttcattcagtcacgatcgttacgacgtgctcaagatgtgaggaagcagctt
ctcagcattatggacaagtataaactagacgtggtaagcgcgggaaagaatttcacaaag
ataaggaaagcaatcacagcaggattcttcttccatggagcaagaaaagatcctcaggaa
ggttacaggacgctagtggagaatcaaccggtttacatacacccgagcagcgctctgttc
cagagacagccagattgggtgatatatcatgatcttgtgatgacgaccaaagagtacatg
agagaagtgactgtgatagacccaaagtggcttgttgagttagctccaaggttcttcaaa
gtcgctgatccaaccaaaatgagcaagcgtaagcgccaagaacgtattgagcctttgtat
gatcgttatcacgagcctaactcttggcgtctcagcaaaagacgtgcttga

DBGET integrated database retrieval system