KEGG   Eutrema salsugineum: EUTSA_v10005781mgHelp
Entry
EUTSA_v10005781mg CDS       T02985                                 

Definition
(RefSeq) hypothetical protein
  KO
K03252  translation initiation factor 3 subunit C
Organism
eus  Eutrema salsugineum
Pathway
eus03013  RNA transport
Brite
KEGG Orthology (KO) [BR:eus00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    EUTSA_v10005781mg
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:eus03012]
    EUTSA_v10005781mg
Translation factors [BR:eus03012]
 Eukaryotic type
  Initiation factors
   eIF-3
    EUTSA_v10005781mg
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: eIF-3c_N PCI TRI5 Sigma70_r4 HTH_Tnp_4 BUD22
Motif
Other DBs
NCBI-GeneID: 18020187
NCBI-ProteinID: XP_006403017
UniProt: V4L2F3
Position
Unknown
AA seq 894 aa AA seqDB search
MTSRFFAQGGSESEDESDFEEEIQEVQNNDINNRYLQDGSVSDDELDTKRVIKPAKDKRF
EEMTNTVDQIKNAMKINDWVSLQENFDKVNKQLEKVMRITEAVKAPTLYIKTLVMLEDFM
NESLANKEAKKKMSTSNSKALNSMRQKLRKNNKLYEEDINKYREAPEVEDDNEPEEEDEE
DEEEEDESEDDVNEEDESGEEVEEPADNRWETMLNKKDKQMEKLLSKDPKDITWDWVNKK
FKEILAARGRKGTARFELVDQLTHLTKIAKTPAQKLEILFSVISAQFDVNPGLSGHMPIK
VWKKCVLNMLTILDILVKYNNIVVDDSVEPDENETSKPADFDGTIRVWGNLVAFIERIDT
EFFKSLQCIDPHTREYVERLRDEPMFLALAQNIQDYLERMGDYKAAAKVALRRVESIYYK
PQEVYDAMRNLAEFIEKDEEAEEAEEENGPPSSFIEVPEVVPRKPTFSESSRAMMDLLVS
LIYRNGDERTKARAMLCDIYHHALMDNFVTARDLLLMSHLQDNIQHMDISTQILFNRTMA
QLGLCAFRAGMITESHSCLSELYSGQRVRELLAQGVSQSRYHEKTPEQERMERRRQMPYH
MHINLELLEAVHLICAMLLEVPNMAANSLEARRRVISKNFRRLLEISERQAFTAPPENVR
DHVMAATRALTKGDFQKAFEVLNSLDVWRLLKNRDSILDMVKARIKEEALRTYLFTYSSS
YESLSLDQLSKMFDVSEAQVHSIVSKMMINEELHASWDQPTQCIVFHEVQHSRLQSLAFQ
LTEKLSVLAESNERAMESRTGGGGLDLSSRRRDNNQDYAGAASGGGKWQDNMNYGQGRQG
NRSGYGGRSSGQSREWSGQNRGGGYVGRVGSGNRGGMQMDGSSRMVSLNRGVRA
NT seq 2685 nt NT seq  +upstreamnt  +downstreamnt
atgacgtctcgttttttcgctcagggtggaagtgaaagtgaagatgagagtgatttcgaa
gaagagatccaggaggttcagaataacgacatcaataaccgttaccttcaagatggcagt
gtctccgatgatgagctcgatactaaacgtgtcattaagcctgcaaaggataagcgtttc
gaggagatgaccaacactgtggatcagattaagaatgccatgaagatcaatgattgggtt
agccttcaggaaaactttgataaagtcaacaagcagcttgagaaagttatgaggatcaca
gaggctgtcaaggctccgactttatatatcaaaacccttgtgatgctggaggatttcatg
aatgaatctctggcgaataaggaagcgaagaagaagatgagcactagtaactccaaggct
ttgaactcaatgagacagaaactgaggaagaacaataagctgtacgaggaagatatcaat
aaatatagggaggctccagaagttgaggatgataatgaaccagaagaggaggatgaagaa
gatgaggaagaggaggatgagtctgaggacgatgttaacgaagaggatgagtctggagag
gaggtggaggaacctgctgataatcgctgggagacgatgctaaacaaaaaagataagcaa
atggagaagctgcttagtaaagatcctaaagacatcacttgggactgggtcaacaagaag
ttcaaagaaatcctggctgctcgtgggaggaagggaactgctcggtttgagcttgttgat
cagcttacacacttgacaaagattgccaagactcctgcgcagaagctcgaaatcttgttt
agcgttatttcggcacagtttgatgtgaatccaggtctcagcggacacatgcctatcaaa
gtctggaagaaatgcgtgctgaacatgctcaccatactggacattcttgtcaagtacaat
aacattgttgtggatgactcggttgaacctgatgagaatgaaacttcaaagccagcagat
tttgatggaacaattcgggtctggggaaatttggttgcattcatagagaggatcgacact
gagtttttcaagagcttgcagtgcattgatcctcacacccgtgagtatgttgagaggttg
agggatgagcccatgttcttggccctagctcagaacatccaggactacttggagcggatg
ggtgattataaagctgctgcaaaggtagccttaagacgagttgagtcaatatattacaag
ccccaggaagtttacgatgctatgaggaatttggctgagttcattgaaaaagatgaagaa
gctgaggaggccgaagaggaaaatggacctccttcttcattcattgaagttccagaggtc
gttccccgtaagcctaccttctcagagagcagcagagcgatgatggatcttcttgtctcc
cttatctacagaaatggagatgagcgaaccaaagcccgtgcaatgctatgtgatatctat
caccatgctttaatggacaactttgtgactgctagagacttgttgctgatgagtcatctc
caagacaacattcagcacatggacatctcaacgcagattctctttaacaggaccatggca
cagcttggtctttgtgccttccgggctggaatgatcaccgagtcccatagctgcctctcc
gagctgtactctggtcaaagagtgagggagttgcttgcccaaggtgtctcgcaaagtcga
tatcatgagaagacaccagaacaggaaaggatggaaaggagaagacaaatgccgtaccac
atgcacatcaacctcgagctcctggaggctgttcacctcatctgtgccatgcttcttgaa
gtcccaaacatggcagcaaactcgcttgaagcaagacgcagagtgattagcaagaatttc
cgtcgcctgcttgagatcagtgagaggcaagccttcactgcaccgcctgagaatgtacgt
gaccatgtcatggcagccaccagagccctgaccaaaggggatttccaaaaggcgtttgaa
gttttgaactctcttgatgtctggagactgctcaagaaccgggacagcatcctcgatatg
gtgaaagctaggatcaaagaagaggctctaaggacttacctattcacatactcgagctcc
tacgagtccttaagtcttgatcagctgtctaagatgtttgatgtctctgaagctcaggtt
cacagcattgtgagcaagatgatgatcaatgaggagcttcatgcaagctgggaccagcca
acacaatgcattgtcttccatgaagtgcaacacagcagactacaatcattggcttttcag
ttaaccgagaaactctcggttttggcagaaagcaatgaaagggcaatggagtctagaacc
ggtggaggtggtcttgatctgagttcaaggagaagggacaacaatcaggactatgcagga
gcggcatcaggtggtggcaaatggcaggacaacatgaattatggacaaggaagacaaggt
aatagatctggatatggtggacgatcgtctggacagtctagagagtggtctggccagaac
agaggaggagggtatgtaggaagagttggttcaggaaacagaggtggtatgcaaatggat
ggctcaagccgtatggtgagtcttaaccgtggtgttcgtgcttaa

DBGET integrated database retrieval system