KEGG   Eutrema salsugineum: EUTSA_v10006697mgHelp
Entry
EUTSA_v10006697mg CDS       T02985                                 

Definition
(RefSeq) hypothetical protein
  KO
K20184  vacuolar protein sorting-associated protein 41
Organism
eus  Eutrema salsugineum
Brite
KEGG Orthology (KO) [BR:eus00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:eus04131]
    EUTSA_v10006697mg
Membrane trafficking [BR:eus04131]
 Endosome - Lysosome transport
  Tethering complex
   Hops complex
    EUTSA_v10006697mg
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Clathrin WD40 ANAPC4_WD40 zf-RING_2 Zn_ribbon_17
Motif
Other DBs
NCBI-GeneID: 18994053
NCBI-ProteinID: XP_006417717
UniProt: V4KEA9
Position
Unknown
AA seq 973 aa AA seqDB search
MAAVPSENGVDGDDEREEEEEEEDEEEEEEENGDEVEEEPRLKYQRMGGNVPALLSNNAA
SCIAVAARMIALGTHDGTVHILDFLGNQVREFRAHTAPVNDLSFDTEGEYIGSCSDDGSV
VINSLFNDDEKMKFEYHRPMKAISLDPDYTKKQSLRFVAGGLSGHLYMNSKKWFGYRDQV
LHSGEGPIHSVKWRASLIAWANDAGVKVYDTAKDQRVTFIERPRGSPRPEALLPHLVWQD
DTLLVIGWGTSVKIASMKSDQKKTTYGTYRQIQMSSLDQVNIVASFQTSYSISGIAPFGD
SLVILAYIPTEDDGEKEFSSTTAVSRQGNAQRPEVRIVSWNSDELTMDALPVHGFEHYKA
KDYSLAHAPFPGSSYAGGQWAAGDEPLYYIVSPKDVVIAKPRDAEDHINWLLQHGFHEKA
LAAVEAGEGRTELIDKVGAGYLDHLIVERKYGEAASLCPKLLRGSASAWERWVFHFAQLR
QLPVLVPYMPTDNPRLKDTVYEVALVALATNPSYHKELLSTVKSWPRSVYSALPVISAVE
PQLNTSSMTDALKEALAELYVIDGQHEKAFSLYADLLKPEVFDFIEKYSLHESIRGKVVQ
LMLLDCKRATALFIQNRDLIAPFEVVPQLLKAGKKCDSRFYLYLYLHALFQVSPSTGKDF
HDMQVELYADYDTKMLLPFLRSSQHYKLEKAYELCVKKDLLREQVFVLGRMGNAKQALAV
IINKLGDIEEAVEFVSMQHDDDLWEELIKQCLNKPEMVGLLLEHTVGNLDPLYIVNMVPN
GLEIPRLRDRLVKIVTDYRTETSLRHGCNDILKTDIVNLLVKCFNEARRGVCLSNEEDDS
RAKREDNSRSSSRGMVVEKSLSTKMTEVKSKTRGDTRCCMCFDPVSIRGDTVVVFFCCHA
YHMTCLMDAAFSNSNNKTTKGSSGYEYGYDNGLEEEEEDEDEDEEDDNGDGDRPGRSRLR
CILCTTAAAASAR
NT seq 2922 nt NT seq  +upstreamnt  +downstreamnt
atggctgcggttccgtctgaaaatggcgtggacggagatgacgaaagggaggaagaagag
gaggaggaggacgaagaagaagaagaagaagaaaacggcgacgaggttgaggaggagcca
cggttgaaataccagcggatgggcggcaacgtacctgcgctgctatctaacaacgctgct
tcctgcatcgctgttgcggcgcggatgatcgcgcttggtacgcacgacggaacggtgcat
atcctcgatttcctggggaatcaggttagagaatttcgtgcccacactgccccggttaat
gacctcagctttgatacagaaggagagtatatcggaagctgttcagacgatggctctgtc
gttataaacagccttttcaacgatgatgagaagatgaaatttgaatatcatcgccccatg
aaggccatttccttggacccagattacacgaaaaagcaatcattgagatttgtagctggt
ggcttgtctggtcacttgtacatgaactccaagaagtggttcggctacagagaccaggtg
ctgcattctggggaaggtccgatccattctgtgaaatggagagcaagtctcatcgcctgg
gctaatgatgctggtgttaaagtttatgatacagccaaagatcagcgtgttacatttatt
gaaagaccgcgaggaagcccccggcctgaggctttgcttccccacttggtttggcaggat
gacactctccttgtgattggttggggaacatctgttaaaattgcttctatgaaatcagac
cagaaaaaaacaacatatggaacgtataggcagattcagatgtctagtctagaccaagtg
aatattgtggcatctttccaaactagctattccatttcagggattgctccctttggtgat
tctctagttattcttgcatatatacccactgaagatgatggtgagaaggaatttagcagc
accactgctgtatcgcgtcagggaaatgcccagaggcctgaagtacgcattgtatcgtgg
aacagtgatgaacttacaatggatgctcttccggtacatggctttgagcattacaaggcg
aaagactattccctggctcatgctcctttcccaggtagtagctatgctgggggacagtgg
gcagctggtgatgaaccattgtactatattgtttctccaaaggatgttgtcattgcaaaa
cccagggatgctgaagatcacattaactggcttttgcaacatggatttcacgagaaagca
ctagcagctgttgaggctggtgaaggacgaaccgaattaattgataaggtgggtgctggg
tatcttgatcatttgattgtggaaagaaaatatggtgaagcagcatctctttgcccaaaa
ttgttacgaggatcagcttcagcctgggagaggtgggttttccattttgctcaactacgc
cagttgcctgttcttgttccatacatgcctaccgataacccaaggctcaaggatactgtg
tatgaggttgctctagtggcgctggcaaccaacccttcatatcacaaggagcttttgtca
actgttaaatcttggccacgttcagtatattctgctttgcctgttatttcagcagtagag
cctcagctgaacacatcttcaatgacggatgctctcaaagaggcgctggcagagctgtac
gtaattgatggacagcacgagaaagccttctccctatatgctgatcttctcaaaccagaa
gtgttcgacttcattgagaaatacagcttgcatgagtcaattcgtggaaaggttgttcag
ttaatgttgcttgattgcaagcgtgccactgcattatttatccaaaatagagatttgatt
gctccatttgaagttgtcccgcaacttctgaaagctgggaaaaaatgtgattcaagattt
tacttgtacttatatctacatgcgttatttcaagtgagcccaagtactgggaaggatttt
catgatatgcaggtagaactatatgcggactacgatactaagatgctgcttccattccta
cgtagcagtcaacattacaagttagaaaaggcatatgaactttgtgtcaagaaagatcta
ttaagagagcaagtgtttgtcctggggaggatgggaaacgcaaaacaagcgcttgctgtt
atcataaataaactgggggatatagaagaggctgtggaatttgtgtccatgcagcacgac
gatgatctatgggaagagctgattaaacaatgtctgaacaagcccgagatggtgggcttg
ctgttggagcacacggttggcaacctcgaccctctttacattgtaaatatggtcccaaat
ggcttggaaatacctcgactaagggatcgattggtcaaaatcgtaacagattacagaact
gagacatctcttagacacggttgcaatgacattctcaagacggacattgttaatcttctg
gtcaagtgcttcaatgaggcgagacgtggggtctgcctaagcaacgaagaagacgattcc
cgtgcgaaaagagaagacaatagccgatcatcttcgcggggaatggtagtagagaaatct
ttgagcacaaagatgacagaagtgaagtcgaagacaaggggagacacacggtgttgcatg
tgcttcgacccggtctcgataagaggggataccgtggtggtcttcttttgctgccatgct
taccacatgacgtgtctcatggatgctgcattcagcaacagcaataacaagacaaccaaa
ggttcttcgggctatgagtatggctacgataacggattggaagaggaggaggaggatgag
gacgaggacgaggaagatgacaatggtgatggagataggcctgggcggtcgcgtttacga
tgcatattatgtactactgccgctgctgcgtccgctcgttag

DBGET integrated database retrieval system