KEGG   Eutrema salsugineum: EUTSA_v10006961mgHelp
Entry
EUTSA_v10006961mg CDS       T02985                                 

Definition
(RefSeq) hypothetical protein
  KO
K12818  ATP-dependent RNA helicase DHX8/PRP22 [EC:3.6.4.13]
Organism
eus  Eutrema salsugineum
Pathway
eus03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:eus00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    EUTSA_v10006961mg
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:eus03041]
    EUTSA_v10006961mg
Enzymes [BR:eus01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     EUTSA_v10006961mg
Spliceosome [BR:eus03041]
 Complex C
  Other components
   Step II factors
    EUTSA_v10006961mg
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HA2 OB_NTP_bind Helicase_C AAA_22 DEAD AAA_30 AAA_19 ABC_tran DUF2075 cobW Helicase_RecD ATPase_2 T2SSE AAA_16 AAA_29 DAP3 AAA_14 AAA_33 AAA_23 Sigma54_activ_2 NB-ARC FtsK_SpoIIIE AAA_7 SRP54 Sigma54_activat MMR_HSR1 PhoH
Motif
Other DBs
NCBI-GeneID: 18992280
NCBI-ProteinID: XP_006415720
UniProt: V4L2W0
Position
Unknown
AA seq 703 aa AA seqDB search
MANLPILQFEEKIVETVEKNPVVVIIGETGSGKSTQLSQILHRRGYTKSGVIAVTQPRRV
AAVSVARRVAQELDVNLGEDVGYAIRFEDRTSSKTRIKYLTDGVLLRESLSNPMLDDYSV
IILDEAHERSLNTDILLGLMKRLVRIRSSNFKVLITSATLDGEKVSEFFSGCPVLNVPGK
LYPVEILYSKERPGSYIESSLKVAIDIHVREPEGDILIFMTGQDDIEKLVSKLEEKVRSL
AEGSCMDAIIYPLHGSLPPEMQVRVFSPPPPNCRRFIVATNIAETSLTVDGVVYVIDSGY
VKQRQYNPSSGMYSLDVIQISKVQANQRAGRAGRTRPGKCYRLYPFAVFRDDFLDATVPE
IQRTSLAGSVLYLKSLDLPDIDILKFDFLDAPSSESLEDALKQLYLIDAIDGNGAITSIG
RTMSELPLEPSLSRTLIEANENGCLSQALTVVAMLSAESNLLPVRSKPNEKKRKHDESNL
PDGSGFGDHIQLLQIFECWDRNNYDTEWCKQNGMQVRGMVFVKDVRRQLCQIMQKISKDR
LEVGARGRNSSSRDDYRKLRKALCVGNANQVAERMLRHNGYRTLSFKPQLMQVHPSSVLS
TDNEGMLPNYVVYHELISTTRPFMRNVCVIEMSWVAPIKRKIEKLNVRKLSGGPANSFKE
PEEKTELSKNNNNAETTPPAVSENVESRIEAARERFLARKGQK
NT seq 2112 nt NT seq  +upstreamnt  +downstreamnt
atggcgaatcttccgatccttcaattcgaagagaagatcgttgaaacagtggagaagaac
ccagtggtagttataatcggagaaaccggctctggaaagagtactcagctctctcagata
cttcatcgacgtggctacacaaagtccggcgtaatcgccgtcactcagccccgacgcgtc
gccgccgtttccgtcgccagacgcgtcgcgcaggagcttgatgtgaatctcggagaagat
gttggttatgcaatacgtttcgaggacagaacttcgagcaaaactcgcattaaatacctt
acagatggagttttacttcgtgagagtctgtctaatccaatgcttgatgattattctgta
atcatattggatgaagctcacgagagaagtttaaacacggatattctgttgggtctaatg
aaacgtttggttagaatccgttcgtctaacttcaaagttcttataacctctgcaacactt
gatggagagaaggtttctgaattcttttcgggctgccctgtgctgaatgtacctggaaaa
ttgtaccccgtggaaatattatacagcaaagagcgccctggcagttatattgagtcatct
ctgaaagtagcaattgatatacatgttcgtgagccagaaggtgatatcttaatcttcatg
actggacaggatgatatagaaaaattagtatcaaagctggaggaaaaagtacgaagctta
gcagaaggatcctgtatggatgctattatttatcctcttcacggatctctgccacctgaa
atgcaggttcgtgtatttagtccacctcctccaaactgccggaggtttattgttgctaca
aatatcgctgaaacttcccttactgtggacggggttgtgtatgtaattgattcagggtat
gtgaagcaaagacaatataacccttcgagtggaatgtattctcttgatgttattcaaatt
agcaaagtgcaagctaaccaacgagctggacgtgctggtagaactagacctgggaaatgt
tatcgattatatcccttcgcagtgttccgggatgacttccttgatgcaacagttcctgaa
atacaacgaacttctcttgctgggagtgttctttacttgaaatcgttggatcttcctgat
attgacattctgaagttcgattttcttgacgctccatcatctgagtcattagaagatgcg
ttgaagcaactgtatctcattgatgcaattgatgggaatggagctataacaagtattggg
cggacaatgtctgagcttccactagaaccatcattgtcaagaacattgatagaagcaaat
gaaaatggttgcttatctcaagctctaacagtagttgccatgttgtcagcagagagtaat
ctacttcctgttaggagcaaaccaaatgaaaagaagaggaagcatgatgaatctaatctc
cctgatggatccggatttggtgatcacattcaattgctacagatttttgaatgttgggac
cgtaataactatgatacggaatggtgcaaacaaaatggaatgcaggtgcgagggatggtg
tttgtcaaagatgttagaagacagttatgtcagattatgcaaaaaatatccaaagatcga
ttggaagttggggcacgtggaaggaatagttcaagccgagacgactacaggaagttgagg
aaagctctatgcgttggtaatgcaaaccaagttgctgagagaatgcttcgtcataatgga
taccggactcttagcttcaagccccagctaatgcaggtgcatccatcatctgtgttgagt
acagacaacgagggaatgttacctaattacgtagtgtaccatgagctgatttccaccaca
cggccgttcatgcgtaatgtttgtgtaatagaaatgtcatgggtggctcccatcaaaaga
aagatcgagaaactaaatgtcagaaaattgagcggtggaccggctaactctttcaaggaa
cctgaggagaagacggagctgtctaagaacaacaacaatgcagaaacaacgccacctgca
gtttctgagaatgttgagagtaggattgaagcggccagggaacggtttcttgctcgtaaa
ggacagaaataa

DBGET integrated database retrieval system