KEGG   Eutrema salsugineum: EUTSA_v10010464mg
Entry
EUTSA_v10010464mg CDS       T02985                                 

Definition
(RefSeq) hypothetical protein
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
eus  Eutrema salsugineum
Pathway
eus00100  Steroid biosynthesis
eus01100  Metabolic pathways
eus01110  Biosynthesis of secondary metabolites
Module
eus_M00917  Phytosterol biosynthesis, squalene 2,3-epoxide => campesterol/sitosterol
Brite
KEGG Orthology (KO) [BR:eus00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    EUTSA_v10010464mg
Enzymes [BR:eus01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     EUTSA_v10010464mg
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295 OPA3
Other DBs
NCBI-GeneID: 18021682
NCBI-ProteinID: XP_006403748
UniProt: V4NGD4
Position
Unknown
AA seq 372 aa
MLDMDLRLLLQSLTPSSQSVYVLVFYFVYLAVAGEILPGKVIRGVLLPDGSQLRYRCNGL
FALTLLVAILGICAKLGIVSPLVVADRGLELLSATFIFCVLVTLALYVTGRSSSDKSSSL
KPHVSGNLVHDWWFGIQLNPQFLGIDLKFFFVRAGMMGWLLINLSILAKSAQDGSLSQSM
ILYQIFCALYILDYFVHEEYMTSTWDIIAERLGFMLVFGDLLWIPFTFSIQGWWLLNNKV
ELTVPAIVANCFVFLIGYMVFRGANKQKHIFKKNPKTPIWGKPPVVVGGKLLASGYWGIA
RHCNYLGDLMLALSFSLPCGISSPVPYFYPIYLLILLIWRERRDEVRCAEKYKEIWAEYL
RLVPYRILPYVY
NT seq 1119 nt   +upstreamnt  +downstreamnt
atgctagatatggatctccgtcttcttctacagtctctcactccctcatcgcaatctgtt
tatgtgctggtgttttacttcgtttacttggccgttgctggagaaattcttcccggaaaa
gttattcgcggcgtacttttaccagatggctcccagcttcgttaccgatgcaatggtcta
ttcgcactaacattactggtcgctattttgggaatctgtgcaaaactcggcattgtatca
cctcttgtggtcgctgatagagggcttgagctactctcagctacttttatcttctgtgtt
ttggtgacattagcattgtatgttactggtcgcagttcctcggataagagttcttccctt
aagcctcatgtctccggaaatcttgtacatgactggtggtttgggattcagctgaatcct
cagtttttgggcatcgatcttaagtttttctttgtcagagccgggatgatgggatggctg
cttatcaatctctctattctggcaaaaagtgcgcaggatggttccttgagtcagtcgatg
attctttaccagatcttctgtgcgttatatatattggactactttgttcatgaagaatac
atgacctctacgtgggacataattgcagagaggttaggcttcatgctggtgtttggagat
ctcctgtggattcctttcacttttagcattcagggctggtggcttttgaacaacaaagta
gagctaacagttcctgctattgtagccaattgctttgtgttcttgatagggtacatggtt
tttcgaggggctaacaaacaaaaacatatctttaaaaagaaccctaaaacccctatatgg
ggtaagcctccagtggtcgttggaggaaagttgctggcttcaggctattggggaatcgca
aggcactgtaattaccttggcgacttgatgcttgctctgtccttcagtttgccctgtgga
ataagttctccagttccatatttctacccgatatacctcctgatactgttaatatggaga
gaacgaagagacgaggttcgatgtgcagagaagtacaaggagatctgggctgagtatctt
agacttgtcccctatagaatccttccttacgtctattaa

DBGET integrated database retrieval system