KEGG   Eutrema salsugineum: EUTSA_v10010560mgHelp
Entry
EUTSA_v10010560mg CDS       T02985                                 

Definition
(RefSeq) hypothetical protein
  KO
K01054  acylglycerol lipase [EC:3.1.1.23]
Organism
eus  Eutrema salsugineum
Pathway
eus00561  Glycerolipid metabolism
eus01100  Metabolic pathways
Module
eus_M00098  Acylglycerol degradation
Brite
KEGG Orthology (KO) [BR:eus00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    EUTSA_v10010560mg
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:eus01002]
    EUTSA_v10010560mg
Enzymes [BR:eus01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     EUTSA_v10010560mg
Peptidases [BR:eus01002]
 Serine Peptidases
  Family S33
   EUTSA_v10010560mg
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_1 Abhydrolase_6 Peptidase_S9 DLH Abhydrolase_2 Chlorophyllase2 FSH1 DUF150
Motif
Other DBs
NCBI-GeneID: 18020784
NCBI-ProteinID: XP_006403484
UniProt: V4LQZ9
Position
Unknown
AA seq 313 aa AA seqDB search
MAHIDGQVGYSEEFIKNSRGIQLLTCKWFPVNQEPRALIFFCHGYAIDCSTTFKEVASKF
AKEGFGVYGIEYEGHGRSGGLSVYIDNFDLLIDDVSSHFSKISEMGENAKKKKFLMGESM
GGAVVLLLHRKKREFWDGGILIAPMCKIAEEMKPPKMVISLMNLVTNLIPSWKSFLSGPD
IINLAIKLPQKRQEIRENPNCYIGRPRMKTMSELYRISLDLENRLNEVTMPFIVLHGEED
KVTDKGASKLLYEVASSNDKTLKLYPEMWHSLLFGEPLEKSEMVFNDIVQWMETRITTLH
VNANNKNEATSHI
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atggctcacattgatgggcaagtcggatatagcgaggaattcatcaagaattcacgggga
atacagctcttaacctgcaagtggtttccagtaaatcaagaaccaagagctctcatcttc
ttttgccatggctatgcaattgattgcagcaccacatttaaagaggttgcatccaagttt
gcaaaagaaggctttggtgtgtatggaattgagtatgaagggcacggaagatcaggcggc
ctttctgtctacattgataacttcgatcttctcatcgatgatgtctcttcacatttctcc
aaaatatctgagatgggagagaacgcaaagaagaagaagtttttgatgggagagtcgatg
ggaggagccgtagttcttctcttgcaccgcaagaaacgtgagttttgggatggaggaatc
cttatagctccaatgtgtaagattgctgaagagatgaaaccaccaaaaatggttatatct
ctgatgaatttggtcacaaatctgatcccatcgtggaagtcgtttctttcgggacctgat
atcatcaatctcgctattaaactccctcaaaagagacaagagataagagaaaatccaaat
tgctacattgggaggcctcgtatgaagacgatgagcgagctttatagaatcagcctagat
ctagagaatcggttgaacgaggtgacaatgccgttcatagtattgcacggagaagaagat
aaagtgacggataaaggagctagcaaacttctttacgaggtggcttcgtctaatgacaag
actttgaagttgtatccagaaatgtggcatagccttcttttcggggagcctttggagaaa
tcagaaatggtgttcaatgacattgtccaatggatggagactagaatcactactcttcat
gtgaatgctaataacaaaaatgaagcaacatctcatatctga

DBGET integrated database retrieval system