KEGG   Eutrema salsugineum: EUTSA_v10011315mgHelp
Entry
EUTSA_v10011315mg CDS       T02985                                 

Definition
(RefSeq) hypothetical protein
  KO
K01938  formate--tetrahydrofolate ligase [EC:6.3.4.3]
Organism
eus  Eutrema salsugineum
Pathway
eus00670  One carbon pool by folate
eus01100  Metabolic pathways
eus01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:eus00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    EUTSA_v10011315mg
Enzymes [BR:eus01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.3  formate---tetrahydrofolate ligase
     EUTSA_v10011315mg
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FTHFS
Motif
Other DBs
NCBI-GeneID: 18011165
NCBI-ProteinID: XP_006393148
UniProt: V4KGU8
Position
Unknown
AA seq 633 aa AA seqDB search
MSSSRKLQVVSPVPADIDVANSVEPLHIAEIAKDLNLSPLHYDLYGKYKAKVLLSAFDEL
QGQEDGYYVVVGGITPTPLGEGKSTTTVGLCQALGAYLDKKVVTCLRQPSQGPTFGIKGG
AAGGGYSQVIPMDEFNLHLTGDIHAITASNNLLAAAIDTRIFHEASQSDKALFNRLCPPN
KEGKRSFSDIMFRRLTKLGISKTSPEDLTPEEIKKFARLDIDPASITWRRVMDVNDRFLR
KITVGQGPEEKGMTRETGFDISVASEIMAVLALTTSLGDMRERLGKMVIGNSKAGDPITA
DDLGVGGALTVLMKDAINPTLMQTLEGTPVLVHAGPFANIAHGNSSIVADKIALKLVGPG
GFVVTEAGFGSDIGTEKFMNIKCRYSGLTPQCAIVVATVRALKMHGGGPDVVAGRPLDRA
YVSENVSLVEAGCVNLAKHISNTKAYGVNVVVAVNMFSTDTEAELNAVRKFSMDAGAFDA
VICSHHAHGGKGAVDLGIAVEKACQNITQPLRFLYPLDISIKDKIEAIAKSYGASGVEYS
DQAEKQIEMYTQQGFSSLPICMSKTQYSFSHDASKKGAPSGFVLPIRDVRGSIGAGFIYP
LVGTMSTMPGLPTRPCFYEIDIDTVTGKVRGLS
NT seq 1902 nt NT seq  +upstreamnt  +downstreamnt
atgagctcatcaagaaagcttcaggttgtttcaccagttcccgccgatatcgacgtcgct
aattccgtcgagcctttacacatcgccgagattgccaaagatctcaatctcagcccactt
cactacgatctctatggcaagtacaaagcaaaggtgttgttgtctgcgtttgatgagctt
caagggcaagaagatggttactatgtggttgttggagggattactccaactcctcttgga
gaaggcaaatcaactaccactgtaggactttgccaagccttaggcgcttacctcgacaag
aaggttgtgacttgtcttcgccaaccatcacaaggaccgacctttggaatcaaaggaggt
gcagctggtggtgggtatagtcaggtgattcccatggatgagttcaatcttcatctcact
ggagatattcacgccattacagcttccaacaatctcttagctgctgcaatcgacactcgg
attttccatgaggcgtctcaatccgacaaggctctctttaataggctttgccctccgaat
aaagaagggaagcgtagtttcagcgacattatgtttaggcggttgacaaagcttgggatc
tccaagaccagtcctgaggatcttactcccgaggagataaagaaatttgctaggcttgat
attgatcctgcttctatcacgtggagaagagtgatggatgttaatgatcggttcttgagg
aagattactgttggtcagggacctgaggaaaaagggatgactagagaaactggatttgac
atttctgttgctagtgagattatggctgttttggctttaacaacctcacttggtgatatg
agagagaggcttggaaaaatggtgattggtaacagcaaggccggtgatccgataacagcg
gatgatcttggtgttggaggagccttgactgttctaatgaaagacgctattaaccccaca
ctcatgcagacacttgaagggacacctgtcctagttcatgctggtccttttgcaaacata
gctcatggaaactcatctatagttgcggataagatcgctttgaagctggtgggacctggt
ggattcgtggtaacagaagcgggttttggttctgacattggtacagagaagttcatgaac
attaagtgccgttacagcgggctaacgcctcagtgtgccattgttgtggcgactgttagg
gccttgaaaatgcatggtggtgggcctgatgttgttgccgggaggcctcttgatcgtgcg
tatgtaagcgagaatgtttccttggttgaagctggatgtgtgaatctagcaaagcatatt
tcaaacacaaaggcgtacggtgtgaatgtagttgttgccgtgaatatgttctcaacagat
accgaagcagaactaaatgcagttaggaagttttcgatggatgctggtgcttttgatgct
gtgatttgttcccaccatgctcatggtggcaaaggagcggtggatcttggtatcgcggtt
gaaaaagcttgtcaaaacattacacagccacttaggtttctatacccactggacattagc
atcaaagataaaattgaagccattgccaagtcctatggagccagtggtgttgaatactca
gaccaggctgagaaacagattgagatgtacactcagcagggcttctccagtcttcccata
tgcatgtccaaaacacagtactcattctcgcacgatgcatcgaagaaaggagcaccttcg
ggctttgtgttgccgataagagatgtaagaggaagcattggagctggattcatttatcct
cttgttggtacaatgagtacaatgcctggacttccgacaagaccttgcttctatgagatt
gatattgacactgtcactggaaaagttcgtggcctttcttaa

DBGET integrated database retrieval system