KEGG   Eutrema salsugineum: EUTSA_v10012105mgHelp
Entry
EUTSA_v10012105mg CDS       T02985                                 

Definition
(RefSeq) hypothetical protein
  KO
K14184  alpha-humulene/beta-caryophyllene synthase [EC:4.2.3.104 4.2.3.57]
Organism
eus  Eutrema salsugineum
Pathway
eus00909  Sesquiterpenoid and triterpenoid biosynthesis
eus01100  Metabolic pathways
eus01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:eus00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00909 Sesquiterpenoid and triterpenoid biosynthesis
    EUTSA_v10012105mg
Enzymes [BR:eus01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.57  (-)-beta-caryophyllene synthase
     EUTSA_v10012105mg
    4.2.3.104  alpha-humulene synthase
     EUTSA_v10012105mg
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Terpene_synth_C Terpene_synth
Motif
Other DBs
NCBI-GeneID: 18010832
NCBI-ProteinID: XP_006393558
UniProt: V4KI09
Position
Unknown
AA seq 400 aa AA seqDB search
MVNPIENIKFIDTLCRLGVSYHFERNILEQVGKSFDSLDFNQMIIHDGCDLYTVGLVFQV
FRQFGFKLPADVFEKFRDGDGKFKGHLAADEYGILSLYEAAQWGTQGEGIIDEALAFSSQ
YLKEFSSRSNNHLTIRIKNALKHPYHKGISRIETRQYISYYEEEESHDATILEFAKIDFN
LLQTLHRKELACVTRWYNKTEIETKVTYSRHRIAEAYLWSLGAYFEPQYSQARVITAVAL
ILFTALDDMYDAYGTMEELELFTDGMEKWLPVAPNGIPESMKHIYRVTVGFYDKLEEELE
KEGRSGCGFHLKKSLKTTANGYMQEAKWLKNNYIATFDEYKENAILSSGYYPLIAMTFAG
MGDVAKLDAFEWLSSNPKIRVASEIISRFTDDISSYEVST
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atggtgaatccgatagagaatatcaagttcattgacactttatgtcgccttggcgtctcc
tatcactttgagagaaacatcttagagcaagtggggaagtcatttgatagtcttgatttt
aatcagatgataatacatgatggatgcgatttatacactgttggactagttttccaagtt
ttcaggcaattcggtttcaaacttccggcagatgtatttgagaagttcagggatggagat
gggaagtttaaaggacacttagccgcagacgaatacggtattctaagcttgtatgaagct
gcacaatggggtacacaaggagaaggcattattgacgaagctctcgccttctcaagccag
tatttaaaagaattttcttctcgatcaaacaaccatctcacaatacgcataaaaaatgcc
cttaaacatccataccacaaaggcatctcaaggatagaaacaagacaatatatctcatac
tacgaggaagaagagtcgcatgacgcaacaatccttgagtttgcaaagatagattttaat
ctgctacagacgttacatcgcaaagagcttgcttgcgtcacaaggtggtacaataaaacg
gaaattgaaactaaagtaacatattccagacatagaatagcagaggcgtacttgtggtca
cttggagcatatttcgagcctcagtattctcaagcacgagttataacagctgttgcacta
atcctattcacagcgcttgatgatatgtatgatgcgtatggcacaatggaggaactagag
cttttcacagatggaatggaaaagtggcttcctgttgccccgaacgggatacctgagagc
atgaagcacatttaccgtgtcacggtaggtttctatgataaactcgaagaggaacttgag
aaggaaggaaggtctggttgtggcttccaccttaagaaatcattgaaaacaacagcgaat
ggatatatgcaagaggcaaagtggttgaaaaataattacattgctacatttgacgagtat
aaagagaatgcaatcttgtcttctggttattatcccttgatagccatgacattcgcggga
atgggagatgtcgcaaaacttgatgcttttgaatggttaagctcaaaccctaaaattagg
gtagcttctgagataatcagccgattcacggatgacatatctagctacgaggtgagcaca
taa

DBGET integrated database retrieval system