KEGG   Eutrema salsugineum: EUTSA_v10012419mgHelp
Entry
EUTSA_v10012419mg CDS       T02985                                 

Definition
(RefSeq) hypothetical protein
  KO
K12818  ATP-dependent RNA helicase DHX8/PRP22 [EC:3.6.4.13]
Organism
eus  Eutrema salsugineum
Pathway
eus03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:eus00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    EUTSA_v10012419mg
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:eus03041]
    EUTSA_v10012419mg
Enzymes [BR:eus01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     EUTSA_v10012419mg
Spliceosome [BR:eus03041]
 Complex C
  Other components
   Step II factors
    EUTSA_v10012419mg
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Helicase_C IBR OB_NTP_bind HA2 zf-RING_UBOX DEAD zf-C3HC4_2 zf-C3HC4 AAA_22 zf-RING_2 AAA_19 KH_1 zf-RING_5 Dna2 Helicase_RecD AAA_30 ABC_tran AAA_29 zf-RING_11
Motif
Other DBs
NCBI-GeneID: 18016844
NCBI-ProteinID: XP_006399531
UniProt: V4LBF6
Position
Unknown
AA seq 1779 aa AA seqDB search
MRSSFPPADGGRSATNRHSPFSSASTNRCNFRSMQSSPPLNHRPTQRHHHCQYPNSYFPP
NYRRDRAPATGISTPCTRIKPNFIVELLHPRTTAANGDAKPSFSVREEEIRSLASLCEIP
EESVHVPQFGCIAGSFSFRQWVDALSSVVALWDYRLQGKHDFVPKLIPNVIVPSDMDELN
DRLRDLFSAHVLSLMENGESVKKVRTEIDERSRQVESFSSKTFLKIEDFEKKKVLEKQKD
LAVERFEEFKNAMKSIVRYLKGNSRSESDGEDVAVFSLEGDYDWPRIHNLIRRECRRLED
GLPIYAYRRNILKKIHGEQIMVLIGETGSGKSTQLIQFLADSGVAASESIVCTQPRKIAA
LTLAERVRIESSGCYEENFVRCTPAFSSTEEISSKVVYMTDNCLLQHYIKDPSLSGISCV
IIDEAHERTLNTDLLLALLKDLLCRRIDLRLVILSATADHDQLSDYFFGCGVLHVSGRNF
PVEIVYSPSYTGETCVVGRIAPYVDEVVKMAVEVHKTEKEGTILAFLTSQAEVEWACERF
IAPFAVALPLHGKLSFEEQFRVFQNHPGRRKVIFATNIAETSLTIPGVKYVIDSGMVKES
KYEPRTGMSILKVCRVSQSSARQRAGRAGRTEAGRCYRLYSQQDFDSMNRNQEPEIRRVH
LGVALLRILALGVDNIADFDFVDAPVPEAIAMAVQNLVQLGAVVEKNGVLELTQEGHCLV
KLGLEPRLGKLILGCFRHRMGKEGIVLAAVMANASSIFCRVGNLDDKMKADCLKVQFCNH
NGDLFTLLSVYKEWASLPRERRNKWCWDNSLNAKSMRRCEDTVKELEKCIERELTLVSPS
YWVWNPTESTKYDKHLKMVILASLAENVAMYTGYEQLGYEVALTGQQVQLHPSCSLLAFG
QKPNWVVFGELLSIADEYLVCVTACDFEALYMLDPPPPFDASQMDDRRLRVEKVVGCSST
VLKRFCGKSNCRLLSIVSRARSLCMDERIGIQVDIDQNEILLYAPPLDMDKVLALVNDAL
ECEKKWMHNECLEKSLFHGRGQVPIALFGSGAQIKHLEVDQRFLTVDVLYYGDNVVDDRE
LVTFLEKNTDGCICSIHKFAANKQDSHEKEKWGRITFLSPESAMKAAEIQRFDFNGSVLK
LFPSLSTGGGGIFRMPSFPSVTAKVRWPRKESIGKGCVKCPSGDVHSIFNGISGLVIGTN
YVHVQRDQKSDDSVLISGLDRNLSEEEVLDVLECATSRRDLTFFLFRKFSVQSSSPTACE
ELLHKRIFGSMSSRNLDPNCVQVQVFEPKETDSFMRATITFDGRLHLEAAKALQELNGEV
LPGCLPWQKIKCEQLFQSSIICSASVYNIVKRQLYDLLSSFERRRGGKWHLEPTLSGAYR
VKIWSYATRTIAEMRRDLEELLRGRHINHPDLIPRVLQHLSTRDGFILMRKIQQETETYI
IFDRHNHTVRICGSREKIAEAEQELVQSLLAYHESKQLEIHLRGPDIRPDLMKEVVKRFG
PELQGIKEKVHDVDLKLNTRNHVIQVHGSKAMRLEVEKMVYELAREKSAPSEEQDDIEVD
CPICLSEVDDGYSLEGCSHLFCKACLLEQFEASMRNFDAFPIVCSHIDCEAPLVLADMRT
LLSQEKLDELFRASLSSFVTASDGKFRFCSTPDCPSIYRVAGPQESGEPFICGACNSETC
TRCHLEYHPYLSCERYKQFKENPDLSLKDWARGKDVKMCPACKSTIEKSEGCNHVQCRCG
KHICWVCLDFFTQSEPCYEHLRTIHGGIGIADDLGNPLF
NT seq 5340 nt NT seq  +upstreamnt  +downstreamnt
atgaggagctcttttcctcccgccgacggtggaagatcggcgactaatcgtcactcgccg
ttttcttccgcttccaccaaccgttgtaactttcgctccatgcagtcttctccgccactc
aatcaccgacctactcagaggcaccaccactgtcagtaccctaattcctatttcccgcca
aattacagacgcgatcgggctccggcgacgggaatctctactccatgtacccgtattaag
ccgaatttcatcgttgagcttcttcacccgagaactaccgccgctaacggcgacgccaag
ccgtctttttcggttagggaggaagagatcagaagcctcgcttcgctctgcgaaatcccg
gaggaatccgtccatgttccccaattcggctgtatcgccggaagtttcagttttcgtcag
tgggtcgacgcgctttcttccgtcgtggctctctgggattatcgccttcaagggaaacat
gatttcgtgcccaagctgattcccaatgtgatcgtcccgtccgacatggacgagcttaat
gacaggcttcgcgatcttttctcggctcacgttctgtcgcttatggaaaacggagaaagc
gtcaagaaggttagaaccgagattgatgagagatctcgtcaagttgaatccttttcgtcc
aaaacttttctcaaaattgaggattttgagaaaaagaaggttcttgagaagcagaaagat
ttggctgttgagcggtttgaagaatttaagaatgccatgaagagcattgtgcgatatctc
aaaggaaacagcaggtctgagtctgatggagaagacgtggccgtgtttagtttggaaggg
gactatgattggccacgtattcataatttgatccgcagggagtgtcgaaggttagaggat
gggctacctatctatgcctacaggcgaaatatcttgaaaaagattcatggcgagcagata
atggtgttgatcggagaaactggttcagggaagagcactcagttaattcagttccttgct
gattccggagttgctgctagtgagtcgattgtttgtacacaaccacggaaaattgctgcc
ttgacattggctgaacgggtcagaatcgaaagcagtggttgttatgaggaaaattttgtc
cgctgcactccagctttctcttctactgaagagattagttccaaagttgtgtacatgaca
gataattgtttgcttcaacactacataaaggatccgagtttgtctggcatttcatgcgtt
attattgacgaagcccatgaaagaaccttaaacacagaccttcttttggcattgctcaaa
gatttgctatgcagaaggattgacctaaggcttgtcattttgtctgccacggctgatcac
gaccaactctcagactatttcttcggctgtggggttcttcatgtaagtgggaggaacttt
ccggtggagattgtgtattctcctagttacacaggagagacttgtgttgttggcaggatt
gctccatatgttgatgaggttgttaagatggcagtggaagtacataaaacagagaaagaa
ggaaccatccttgctttcttgacttcccaagcagaggttgaatgggcatgcgagaggttt
atagctccatttgcagttgctttgcctttgcatggaaagctttccttcgaagaacaattt
agggtcttccagaaccatcctgggagacgaaaagtgatatttgccacaaatatcgcagag
acatcgctgactattcctggtgtcaagtatgtaattgattccggaatggtgaaagagagt
aaatatgaacctagaacaggtatgagcatcctcaaggtttgccgggtcagtcagagttct
gctcgacaacgtgctggtcgtgctggcaggacagaagccggaagatgttacagactgtac
tcacaacaagattttgattcaatgaatcgtaatcaggaacctgaaattcggagggtccat
cttggtgtagcacttttgaggattcttgctctgggtgtagacaacatagctgattttgac
tttgttgacgcgcctgtccctgaagccattgcaatggctgtccagaatcttgttcagttg
ggtgcagtcgttgagaagaacggtgttcttgaattaacacaggaagggcattgcttagtc
aagctgggtttggaaccaaggcttggaaagttaattttaggctgcttcagacacagaatg
ggtaaagagggaattgttcttgctgctgtcatggctaatgccagcagtatattttgcaga
gttggcaacctcgatgataagatgaaagctgattgcctaaaggtacaattctgcaatcat
aatggagacctgtttactcttctttcggtttacaaagaatgggcatctctgccgcgagag
agaagaaataaatggtgctgggataacagcctgaatgcaaaatcaatgaggagatgtgaa
gacacagtgaaggaattggagaaatgcattgagagagaactcactcttgtcagtcctagt
tactgggtttggaatccaactgagagcactaaatacgataagcatttgaaaatggttata
cttgcatctcttgcagagaatgtggcgatgtacactggctatgagcagcttggatacgag
gtggcacttactggtcaacaagttcagttacatccgtcgtgttctttgctagcatttggc
cagaagccaaactgggttgttttcggtgaacttctatcaattgctgatgagtacttggta
tgtgtaactgcgtgtgattttgaggctttgtatatgcttgatccacctccaccttttgat
gcatctcagatggatgaccggaggctccgagtggaaaaagtggttggttgtagtagcact
gtgctaaaacgattctgtgggaaatctaactgtagactgctttcaattgtttctcgtgct
aggtctctctgtatggacgaaaggattggtattcaagtcgatattgatcagaatgagatt
ctactgtatgcgcctcccctcgacatggacaaagtgttagcccttgtgaacgatgcattg
gaatgtgaaaagaaatggatgcataatgaatgtttggagaagtctctatttcatggtcgg
ggacaagtacctattgcactgtttggatctggtgctcagataaagcatcttgaagttgac
cagaggtttttgacagttgatgtactttattatggcgacaatgttgttgatgacagagaa
cttgtgacatttctggaaaagaatactgatgggtgtatttgctctattcataagtttgct
gctaacaagcaagacagtcatgagaaggaaaagtggggtaggataacctttctctctccg
gaatctgctatgaaggcagcagaaattcagagatttgatttcaatggatcagtgcttaaa
ttatttccatcgctgtcaacaggtggtgggggaattttcaggatgccttctttcccttct
gttacagctaaggttcgttggccgcgaaaggaaagcattggtaaaggctgtgttaagtgc
ccttctggtgatgttcacagtatatttaatgggatctccggccttgtgataggtacaaat
tatgtccacgttcagagagatcaaaagtccgatgactctgtcttgataagtgggcttgac
agaaatctttcggaagaagaagttctagatgttttagagtgcgctacgtccagaagagat
ctgactttttttttattcagaaaattcagtgtgcagagttcatcacctactgcttgcgaa
gaactgctgcataagagaatatttggatccatgtcatcgaggaatttagatccgaactgt
gtccaagtccaagtttttgaaccaaaagaaacagattctttcatgcgagcgactattaca
tttgacgggagattacatttggaagctgcgaaagctttgcaggagttaaatggagaggtg
ctacctggatgccttccatggcagaagataaagtgtgagcaattgtttcagagctccata
atctgctctgcttctgtctacaacatagtcaaaagacagttatatgatttgttatcaagc
tttgaaagacgaagaggaggtaaatggcatttggagccaactctcagcggtgcttatcgt
gttaaaatttggtcttatgcaacaagaaccatcgcagagatgcggagagatcttgaagaa
ctcttgagaggaaggcacataaatcatccagacttaatccctagagtcttgcagcatctt
tcgaccagagatggttttattctgatgcggaagatccaacaagagacagaaacttacatt
atatttgacaggcacaatcacacagtacgcatttgtggatcacgagagaaaatcgctgag
gctgaacaagaactggttcagtcacttctggcctatcacgagagtaagcaacttgaaatc
cacctccgaggtcctgatattcgtcctgacctcatgaaggaagttgtgaagaggtttggt
ccggagctccaaggtatcaaagagaaggtacatgatgtggatctcaagctcaacacccgg
aaccatgttattcaagttcacgggagcaaagcaatgaggctggaagtagaaaagatggtc
tatgaacttgcacgagaaaagagtgcaccgagcgaagaacaagatgacattgaagttgac
tgtcccatttgcttgtctgaggttgatgatggctactctcttgaaggatgttcacacctc
ttctgcaaagcctgtttgttggaacaatttgaggcatcgatgagaaactttgacgcattt
cccatagtttgttctcacattgactgtgaagctccattagtactcgctgatatgagaact
ctcttatcacaagagaagctcgatgaactcttccgagcatccttgtcctcttttgtaaca
gctagtgatggaaagttccggttttgctccacacctgattgcccgtccatctaccgtgta
gctggccctcaagaatccggcgaaccattcatctgtggagcctgcaactcagagacatgc
acaaggtgtcaccttgagtatcacccgtatctctcttgtgaaaggtacaaacagttcaag
gagaatccggacttgtcgctaaaggactgggcaagagggaaggacgtgaagatgtgtccg
gcttgcaagtccacgatagagaaatctgaagggtgtaaccatgtgcagtgccggtgtggg
aagcacatttgctgggtctgcttggacttcttcactcagtcagaaccttgctatgagcat
ttaaggacaattcatggtggaatcggcattgcggacgaccttggtaaccccctgttttga

DBGET integrated database retrieval system