KEGG   Eutrema salsugineum: EUTSA_v10012940mgHelp
Entry
EUTSA_v10012940mg CDS       T02985                                 

Definition
(RefSeq) hypothetical protein
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
eus  Eutrema salsugineum
Pathway
eus00970  Aminoacyl-tRNA biosynthesis
eus01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eus00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    EUTSA_v10012940mg
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:eus03029]
    EUTSA_v10012940mg
Enzymes [BR:eus01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     EUTSA_v10012940mg
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     EUTSA_v10012940mg
Mitochondrial biogenesis [BR:eus03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    EUTSA_v10012940mg
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-GeneID: 18016427
NCBI-ProteinID: XP_006401770
UniProt: V4KZ12
Position
Unknown
AA seq 611 aa AA seqDB search
MCSFSIRKSPNSSFIFPKFAPLLVRHCLTLPSLVPILKPPRFRVVASLSGTSWVSQASKE
KYGGWALIEDEAPLPHWKSKKKWRNVVITGVGSSLSSRPIVSAASSTIDAATVSPPQSQI
LSTRRSLLSGETTASEIAKSYLSRIRLTEPQLKCFLHISENVLKDAQEIDARIARGEELG
PLAGVFIGVKDNICTEGMPSTAASRILEHYRPPFDATAVKKIKELGGIVVGKTNMDEFGM
GSTTEASAFQVTANPWDLTRVPGGSSGGSAAAVAARQCMVSLGSDTGGSVRQPASFCGVV
GLKPTYGRVSRFGLMAYASSLDVIGCFGSTVADAGMLLHAISGYDRFDSTSSKQDVPEFQ
SQFLSVDSFESKPLKGVKVGLIRETLEEGVDCGVRSATQEAASHLEALGCLVTEVSLPSF
SLGLPAYYVIASSESSSNLSRYDGVRYGNQVMAEELNKLYECSRGEGFGGEVKMRILMGT
YALSAGYYDAYYKRAQQVRTIIRKDFKAALDQNDILISPAAPSAAYKIGEKKDDPLAMYA
GDIMTVNVNLAGLPAIVLPCGLVEGGPSGLPVGLQIIGAAFDEEKLLKVSHIFEQTLKGS
SFVPPLLPNVA
NT seq 1836 nt NT seq  +upstreamnt  +downstreamnt
atgtgctcattttcgattagaaagtcaccaaattcatcattcatcttcccaaaattcgct
cctttacttgtaaggcattgtttgactctcccatcactcgttcccattctcaaaccgccg
agattccgcgtcgtcgcttctctctccggtacctcatgggtctctcaagcttccaaagaa
aaatatggtggttgggctcttattgaagatgaagctcctcttcctcattggaaaagtaaa
aaaaagtggcggaatgttgtaatcactggtgttggatcgtcactaagctctagaccaatc
gtatccgcagcttcctcgacaatcgacgctgctaccgtctctcctccgcaatctcagatt
ctcagcactcgacgctctctcctctccggcgaaaccacagcttctgagatcgcaaaatcc
tacctctcccgtatccgtctcaccgaaccgcagctcaaatgcttccttcacatatcggag
aatgtcctgaaagatgctcaagagatcgatgcacgaatcgccagaggtgaggagttaggt
cctctcgccggagttttcatcggcgtcaaggataacatctgcacggaaggcatgccttct
accgccgcgtctcgcatcttagagcattatcgtcctccgttcgatgcgacggcggtgaag
aagatcaaggaattgggagggattgtagttgggaagaccaatatggatgagttcggtatg
ggaagcacaactgaagcttctgcatttcaggtaactgcgaatccatgggacttgacccgt
gtaccgggaggttcgtcaggaggttcagcagcagctgttgcagcaagacaatgtatggtg
tctcttggtagtgatactggtggaagtgtgagacagccagcttcgttctgtggtgttgtt
ggtcttaaaccaacttacgggcgtgtctctaggtttggacttatggcctatgcatcttcg
ttggatgtgatcggttgctttggctctacggttgctgatgctgggatgcttcttcatgct
atttccgggtatgacaggttcgactccacgagtagcaaacaagatgtgcctgagttccaa
tcacagtttctttctgtggattcttttgaatctaaaccattgaagggagtgaaagttggt
ctgattcgtgagacacttgaagaaggtgttgattgtggggtgagatctgcaactcaggaa
gctgcgtctcacttagaagcattgggttgtttagtgacagaggtgtcacttccttcattc
tctctgggactaccagcctactatgtgattgcctcgtctgaatcatcttcgaatttatca
cgttatgatggtgtcagatatgggaatcaagttatggctgaagagctcaataagctgtat
gaatgttcccgtggagaaggatttggcggagaggtgaaaatgagaatcttaatgggaaca
tatgcactctctgctggttactacgatgcatactacaagcgagctcaacaggtgagaaca
ataattcgaaaagacttcaaagccgctttggatcagaacgatattcttatctctccagca
gctccatctgctgcatacaagattggtgaaaagaaagatgatccattggcaatgtatgct
ggagacattatgacggtcaatgtgaatctcgcggggcttcctgcgattgtattaccatgt
ggactagtcgaaggaggtccctcgggtctacctgttggtcttcaaattatcggtgcagcc
tttgatgaggagaaattgctgaaagtgagtcacatatttgagcagactctcaaaggttca
agctttgttcctccattgttaccaaatgttgcctaa

DBGET integrated database retrieval system