KEGG   Eutrema salsugineum: EUTSA_v10013706mgHelp
Entry
EUTSA_v10013706mg CDS       T02985                                 

Definition
(RefSeq) hypothetical protein
  KO
K00231  protoporphyrinogen/coproporphyrinogen III oxidase [EC:1.3.3.4 1.3.3.15]
Organism
eus  Eutrema salsugineum
Pathway
eus00860  Porphyrin and chlorophyll metabolism
eus01100  Metabolic pathways
eus01110  Biosynthesis of secondary metabolites
Module
eus_M00121  Heme biosynthesis, glutamate => heme
Brite
KEGG Orthology (KO) [BR:eus00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    EUTSA_v10013706mg
Enzymes [BR:eus01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     EUTSA_v10013706mg
    1.3.3.15  coproporphyrinogen III oxidase (coproporphyrin-forming)
     EUTSA_v10013706mg
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Amino_oxidase NAD_binding_8 Prenylcys_lyase
Motif
Other DBs
NCBI-GeneID: 18017183
NCBI-ProteinID: XP_006399932
UniProt: V4KTV4
Position
Unknown
AA seq 405 aa AA seqDB search
MAPDAVADHDKKFEALSGKRVAVVGAGVRLKSRGLNVTVFEADGRAGGKLRSVMHKGLIW
DEGANTMTEAEPEVGSLLDDLGLREKQQFPISQKKRYIVRNGLPVMIPTNPIALVTSSVL
STHSKFQILLEPFLWKKNDSSSKVSDASTVESVSGFFQRHFGQEVVDYLIDPFVGGTSAA
DPDSLSMKHTFPDLWNIEKSFGSIIVGAIRTKFAAKGGKSGETRTSPGTKKGSRGSFSFK
GGMQILPDMLCKDLSHDELNLDSKVLSLSYNSGSRQENWSLSCVSHNETLRQNLHYDAVV
MTAPLCNVKEMKVVKGGQPFQLNFIPEIKYMPLSVIITTFTKEKVKRPLEGFGVLIPSKE
EKHGFKTLGTLFSSMMFPDRCPSDLHLYTTFVGGSRNQELAKAST
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atggcgcctgacgcagtagcagatcatgataaaaaatttgaagcactttcaggcaaaaga
gttgcagtcgtaggtgcaggtgtaaggttgaaatcgaggggtttgaatgtgactgtgttt
gaagctgatggaagagcaggtgggaagctgagaagtgttatgcataagggattgatttgg
gacgaaggagcaaacaccatgactgaggctgagccagaagttggaagtttgctagatgat
cttgggcttcgtgagaaacagcagtttccaatttcacagaaaaaacgctatattgtgcgg
aatgggttacctgtgatgatacccaccaatcccattgcgttggtcacaagtagtgtgctc
tctacccattctaagtttcaaatcttgttggaaccatttttatggaagaaaaatgactcg
tcctcaaaagtgtctgacgcatctacagtagaaagtgtaagcgggttcttccaacgccat
tttggacaagaggttgtggattatctcatagatccttttgttggtggaacaagtgctgcg
gatcctgactccctttcaatgaagcatacttttccagatctctggaatatagagaaaagt
tttggctctattatagtcggtgcaatcagaacaaagtttgctgctaaaggtggtaaaagc
ggtgaaacaaggacttctcctggcaccaaaaagggttcgcgagggtcattctctttcaag
gggggcatgcagattcttcctgatatgttgtgcaaagacctctcacatgatgagctcaat
ttagactccaaggttctctctttgtcttacaattctggatcaagacaggagaactggtca
ctatcctgtgtctctcataatgaaacgttgagacaaaacctccattatgatgccgtagtt
atgacggctcctttgtgcaatgtgaaggagatgaaggttgtgaaaggaggacaacccttt
caactaaactttatccccgagattaaatatatgcccctctcggttataatcaccacattc
acaaaggagaaagtaaagagacctctcgaaggttttggtgtactcattccatcaaaggag
gaaaagcatggtttcaaaactctgggtacactcttttcctcaatgatgtttccagatcgt
tgccctagtgaccttcatctatatacaacttttgttggtgggagtaggaaccaggaacta
gccaaagcttccacgtaa

DBGET integrated database retrieval system