KEGG   Eutrema salsugineum: EUTSA_v10016818mgHelp
Entry
EUTSA_v10016818mg CDS       T02985                                 

Definition
(RefSeq) hypothetical protein
  KO
K01988  lactosylceramide 4-alpha-galactosyltransferase [EC:2.4.1.228]
Organism
eus  Eutrema salsugineum
Pathway
eus00601  Glycosphingolipid biosynthesis - lacto and neolacto series
eus00603  Glycosphingolipid biosynthesis - globo and isoglobo series
eus01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eus00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00601 Glycosphingolipid biosynthesis - lacto and neolacto series
    EUTSA_v10016818mg
   00603 Glycosphingolipid biosynthesis - globo and isoglobo series
    EUTSA_v10016818mg
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:eus01003]
    EUTSA_v10016818mg
Enzymes [BR:eus01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.228  lactosylceramide 4-alpha-galactosyltransferase
     EUTSA_v10016818mg
Glycosyltransferases [BR:eus01003]
 Glycan extension
  P blood group
   EUTSA_v10016818mg
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Gb3_synth Gly_transf_sug Caps_synth TcdA_TcdB
Motif
Other DBs
NCBI-GeneID: 18026791
NCBI-ProteinID: XP_006411018
UniProt: V4NZP9
Position
Unknown
AA seq 371 aa AA seqDB search
MEKGNNAGILYKHTNSPVFSTTIFAVIMLLIVAGTILSNMSLESTFFWASPTSEVIQMNR
MERKSLAPPKNSTSRYRIAWLRSHLPEFEVRFFMTWFSPAEFFGKRELLAVESVFKSHPQ
GCLMIVSGSMDSLKGDSILKPLLDLGYKVYTATPDISLLLEDTPAKAWFQEMKSCRRDPG
RIPLSQNLSNLARLAILYKYGGVYLDTDFIVTRSFKGLRNSIGAQTVVEGDSKNWTRLNN
AVLIFEKEHPLLYHFIEEFASTFDGNKWGHNGPYLVTRVVQRAQETLGNNFTVLPPVAFY
PFNWLDIQILFRTPRSSNDSTLLKADLVKLNKGSYGLHLWNKITKKLKIGKGSAIDIIIS
DHCVVCRGIQR
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atggagaaaggtaataatgctggtattctctacaagcacacgaattcgccggtattctct
acaaccattttcgcggtcataatgctgctcattgtcgcgggaacaattctctcaaacatg
tctttagaatccactttcttctgggcttcaccgacctctgaggtaatacaaatgaacaga
atggaaagaaagtcattggctcctccaaagaacagtacaagcagataccggatcgcttgg
cttcgatcacatctcccagaattcgaggtcagattcttcatgacatggttttcaccagca
gagtttttcgggaagagagagcttctagccgtagaaagtgtcttcaaatctcatcctcaa
ggatgcttgatgattgtatcaggatccatggattctttaaaaggagatagcatcctaaag
ccgctacttgatctcggttacaaggtttatacagcaacaccagacatttcgttgctgctt
gaggacacaccagccaaagcttggtttcaagaaatgaaaagctgcagaagagatccagga
aggatacctttatctcagaatctttcaaacctagcaagactagcgattctatacaagtac
ggaggtgtttacttggataccgacttcatcgtcactagaagctttaaagggctgagaaat
tcgataggagcgcaaacagtggtggaaggagactcaaagaactggacaaggttgaacaat
gcggttcttatcttcgagaaagaacacccgcttctttaccatttcattgaggagtttgct
tcgacttttgatgggaacaaatggggacacaatggcccctacttggtaaccagagtagtg
cagagagcacaagaaacacttgggaacaatttcacagttttgccaccagtagcattctat
ccatttaattggttagacattcaaatactgtttcggacgccaaggagtagcaatgactcg
acattactcaaagccgatctggtcaagctcaacaaaggaagctacgggctgcatctgtgg
aacaagatcaccaaaaaacttaagatcggaaagggcagtgccatagacatcataatttcg
gaccactgtgttgtttgcagaggaattcaaagatga

DBGET integrated database retrieval system