KEGG   Eutrema salsugineum: EUTSA_v10017228mgHelp
Entry
EUTSA_v10017228mg CDS       T02985                                 

Definition
(RefSeq) hypothetical protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
eus  Eutrema salsugineum
Pathway
eus00480  Glutathione metabolism
eus01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eus00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    EUTSA_v10017228mg
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:eus02000]
    EUTSA_v10017228mg
Enzymes [BR:eus01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     EUTSA_v10017228mg
Transporters [BR:eus02000]
 Other transporters
  Pores ion channels [TC:1]
   EUTSA_v10017228mg
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_C GST_N GST_N_3 GST_N_2 GST_C_3 GST_C_2 Glutaredoxin
Motif
Other DBs
NCBI-GeneID: 18026952
NCBI-ProteinID: XP_006410183
UniProt: V4NXK2
Position
Unknown
AA seq 215 aa AA seqDB search
MVLKVYGPHFASPKRALVTLVEKGVAFETIPVDLMKGEHKQPAYLALQPFGTVPAVVDGD
YKIFESRAVMRYVAEKYRSQGPDLLGKTVEDRGQVEQWLDVEATTYHPPLLNLTLHVMFA
SVMGFPADQKLIKESEEKLAAVLDVYEAHLSKSKYLAGDFVSLADLAHLPFTDYLVGPIG
KAYMIKDRKHVSAWWDDISSRPAWKEVLEKYSLPA
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atggtgctaaaggtgtacggacctcactttgcttcaccgaagcgagctctggtaacactg
gtcgagaagggcgttgccttcgagaccatccccgtcgatctcatgaaaggagagcacaag
cagcctgcttacctcgcgttacagcctttcggtaccgttcctgctgttgtcgacggagac
tacaaaatcttcgagtctcgtgcggtgatgaggtacgtagctgagaagtacaggtcacaa
ggacctgaccttttggggaaaaccgtggaagacagaggccaagtagagcaatggctcgac
gtggaggcaaccacttaccacccaccgctacttaacctaacactgcacgtaatgttcgcg
tcggtcatgggattcccggctgatcagaagctgatcaaggagagcgaagagaaactcgcg
gctgttcttgatgtgtacgaggcacatctatcaaagagcaagtacttggctggtgatttt
gtgagccttgctgatttggctcaccttcccttcactgattacttggttggtcccataggg
aaggcttacatgatcaaagataggaagcatgtgagtgcatggtgggacgatattagcagc
cgtcctgcgtggaaggaggttcttgagaagtattcactcccggcttaa

DBGET integrated database retrieval system