KEGG   Eutrema salsugineum: EUTSA_v10018851mgHelp
Entry
EUTSA_v10018851mg CDS       T02985                                 

Definition
(RefSeq) hypothetical protein
  KO
K01757  strictosidine synthase [EC:4.3.3.2]
Organism
eus  Eutrema salsugineum
Pathway
eus00901  Indole alkaloid biosynthesis
eus01100  Metabolic pathways
eus01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:eus00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00901 Indole alkaloid biosynthesis
    EUTSA_v10018851mg
Enzymes [BR:eus01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.3  Amine-lyases
    4.3.3.2  strictosidine synthase
     EUTSA_v10018851mg
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Str_synth SGL NHL Arylesterase
Motif
Other DBs
NCBI-GeneID: 18008275
NCBI-ProteinID: XP_006390479
UniProt: V4JR85
Position
Unknown
AA seq 329 aa AA seqDB search
MTSFLSVISLLLILSLSSAVFSNATPFQKIPVPGKRSGPEAFAFDSTGKGFYTGVSGGKI
LKYLPQKGYVDFGYITESSKSQSCDGALGTANIGKCGRPAGIAFNDKTGELYVADAPLGL
HVISRGGGLAKKIADNIDGKPFLFLDGLDVDPTTGVVYFTSFSSKFSPGDVLKAVASKDA
TGKLFKYDPSKKVVTVLMEGLSGSAGCAVSSDGSFVLVSQFTKSNIKRYWIKGPKAGSSE
DFTNSVSNPDNIKRIGSSGNFWVASVVNTATGPTNPSAVKVNSDGKVLHTISVKDKFGDT
LVSEVNEFKGQLYVGTLFGPFAGILKLKK
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgacatcctttctctccgtaatttctcttcttcttattctctctctttcttctgcggtt
ttctcaaacgctacacctttccagaaaattccggtgccgggaaagaggtcaggccctgaa
gcttttgcttttgattccaccggaaaaggtttctacaccggagtctccggaggtaaaatc
cttaaatacctaccgcagaaaggttacgtcgattttggctatatcacggaatcctcgaag
tcacaatcgtgcgacggagcacttggaaccgctaacatcggaaaatgcggccggccggcg
ggaatagctttcaacgacaaaacaggagagctctacgtcgccgatgctccgttgggtctc
cacgtcatttctcgcggcggcggtttggccaagaagatcgccgataatattgacggcaag
cccttcttgtttctcgatggtctagacgttgatcccaccaccggcgtcgtctatttcact
tccttcagctcaaaatttagccctggggatgtgttgaaagcagttgcatcaaaagacgct
actggaaaactcttcaaatacgatccatcaaagaaagtcgtgactgtattgatggaaggc
ctaagtggctcagctggatgcgcagttagctcagacggctccttcgtgttggttagtcag
ttcacaaaaagtaacatcaagaggtattggatcaaaggacctaaagctggttcttctgaa
gacttcaccaattcggtctcgaaccctgacaacatcaagagaatcggttcttccggaaac
ttttgggttgcttcggtcgtgaacacggccactggaccaacaaacccgtcggcggttaaa
gtcaattctgacggtaaagtcctccatacaatttctgtgaaggataagtttggggatact
ttggtcagtgaggttaacgaattcaaaggacagctttacgtcggaacactctttggacct
ttcgccgggattcttaagctcaaaaagtaa

DBGET integrated database retrieval system