KEGG   Eutrema salsugineum: EUTSA_v10019707mgHelp
Entry
EUTSA_v10019707mg CDS       T02985                                 

Definition
(RefSeq) hypothetical protein
  KO
K09840  9-cis-epoxycarotenoid dioxygenase [EC:1.13.11.51]
Organism
eus  Eutrema salsugineum
Pathway
eus00906  Carotenoid biosynthesis
eus01100  Metabolic pathways
eus01110  Biosynthesis of secondary metabolites
Module
eus_M00372  Abscisic acid biosynthesis, beta-carotene => abscisic acid
Brite
KEGG Orthology (KO) [BR:eus00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00906 Carotenoid biosynthesis
    EUTSA_v10019707mg
Enzymes [BR:eus01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.51  9-cis-epoxycarotenoid dioxygenase
     EUTSA_v10019707mg
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RPE65
Motif
Other DBs
NCBI-GeneID: 18008196
NCBI-ProteinID: XP_006389988
UniProt: V4K8C6
Position
Unknown
AA seq 611 aa AA seqDB search
MASISTTLLPSTSTQFQDRTFSTSSSSSSSPSIQSLSFSSSSTLGNKKQNPCSVSQSVNK
KLTVSSSQQSPTTYQLQKELCNDAASLIPKMTNQSPKLNPVQRTAATILDAVENAMLSHE
RRRHPLPKTADPAVQIAGNFFPVPEQPVRHNLPVSGTVPECIQGVYVRNGANPLHKPISG
HHFFDGDGMIHAVRFDNGSVSYACRFTETNRFVQERELGRSVFPKAIGELHGHLGIAKLM
LFNARGLFGLVDPTHGLGVANAGLVYFNGHLLAMSEDDLPYHVRVTPTGDLETSGRYDFD
GQLKSTMIAHPKIDPETRELFALSYDVVSKPFLKYFRFTPDGEKSPDVEIPLDQPTMIHD
FAITENLVVIPDQQVVFRLPEMIRGGSPVVYDKKKKSRFGILNKYAEDASSIRWIEVADC
FCFHLWNAWEEPETDEIVVIGSCMTPPDSIFNEHDEETLESVLSEIRLNLKTGESTRRPV
ISEKVNLEAGMVNRNFLGRKTRFAYLALAEPWPKVSGFAKVDLSTGEIQKYIYGHGKYGG
EPLFMPDVSGDGEDNGYIMVFVHDEEKVKSELQIINAVNLKLEATVTLPSRVPYGFHGTF
ISNEDLMKQAL
NT seq 1836 nt NT seq  +upstreamnt  +downstreamnt
atggcttctatttctactaccttacttccttctacttcaacccaatttcaagatcgaact
ttctcaacctcttcttcttcttcttcgagccccagtattcaatctctgtcgttttcctct
tcctccacactcggaaacaagaaacaaaacccttgctctgtttctcagtccgtcaacaaa
aaactaaccgtttcgtcttctcaacaatctccaacgacataccaactacaaaaggaacta
tgtaacgatgcagccagtttgatccccaaaatgacgaaccagagcccaaaattaaacccg
gtgcagagaaccgccgcgacgatcttagacgcggtggagaacgccatgctttcgcacgag
cgccgccgtcatccgcttcctaaaacggcggaccccgccgtgcaaatagccggaaacttc
ttcccggtcccggagcaaccagtccgtcataatcttccggtgagtggaacagtaccagag
tgtattcaaggagtgtatgtcagaaacggtgctaatccgcttcacaagccaatctccggc
caccatttcttcgacggagacggtatgattcacgctgtccggttcgataacggttcggtt
agctatgcgtgccggtttaccgaaacaaaccggtttgttcaagagcgagaattgggtcgc
tctgttttccccaaagcgattggagagcttcacggacatttaggcatagccaagcttatg
ctcttcaatgcccgaggactattcgggttagtcgacccgacccatggactcggtgtcgct
aatgccggtttagtctatttcaacggtcatctcttggccatgtccgaagacgatctaccg
taccatgtcagagtcactccaaccggagatttagagacttcgggtcggtacgatttcgac
ggccagctaaaatccacaatgattgcccacccgaaaatagacccggaaacccgagaacta
ttcgctcttagctacgacgtcgtttctaagccgttcttaaaatacttcagattcacaccc
gacggcgaaaaatctccagacgtcgagattccgcttgatcaacctactatgatccacgat
ttcgcgatcacagagaatctcgtagtgattccagaccaacaagtggttttccgattgcct
gagatgatccgaggtggttcccctgtggtttacgacaagaagaagaaatcgagattcggg
attttgaataaatacgcggaagatgcttcgtcgattcgatggatcgaagtagctgattgc
ttctgtttccatctatggaacgcttgggaagaaccagaaacagacgagattgtcgtgatt
gggtcatgtatgacgccacctgattcaattttcaacgaacacgacgaagaaacacttgag
agtgttttgtcggagataaggctaaacctgaaaacaggggaatccacgcgtcgaccggtt
atctccgaaaaagtgaacctcgaagccggtatggtaaaccgaaattttttaggtagaaaa
acccggttcgcttaccttgctttagctgaaccgtggcctaaagtgtccggtttcgcgaaa
gttgatttgtcgaccggagagattcaaaagtatatatacggacatggaaaatacggagga
gagcctctgtttatgccggatgtttccggcgacggagaagacaacggttacattatggtg
tttgttcacgacgaggagaaagtgaaatcagagctccaaatcattaacgccgttaatctg
aagcttgaagctactgttacgcttccgtcgagagtgccttacggtttccacggaacgttc
atcagtaatgaagatctaatgaagcaagctttgtga

DBGET integrated database retrieval system