KEGG   Eutrema salsugineum: EUTSA_v10020195mgHelp
Entry
EUTSA_v10020195mg CDS       T02985                                 

Definition
(RefSeq) hypothetical protein
  KO
K08867  WNK lysine deficient protein kinase [EC:2.7.11.1]
Organism
eus  Eutrema salsugineum
Brite
KEGG Orthology (KO) [BR:eus00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:eus01001]
    EUTSA_v10020195mg
   01009 Protein phosphatases and associated proteins [BR:eus01009]
    EUTSA_v10020195mg
Enzymes [BR:eus01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     EUTSA_v10020195mg
Protein kinases [BR:eus01001]
 Serine/threonine kinases: Other
  Wnk family
   EUTSA_v10020195mg
Protein phosphatases and associated proteins [BR:eus01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     EUTSA_v10020195mg
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr OSR1_C Pkinase_fungal DUF2052 TMEM51
Motif
Other DBs
NCBI-GeneID: 18024492
NCBI-ProteinID: XP_006408136
UniProt: V4M0I7
Position
Unknown
AA seq 652 aa AA seqDB search
MEDYRAFDEYEGIEVAWNQVKLYDFLQSPEDLERLYCEIHLLKTLKHKNIMKFYTSWVDT
ANRNINFVTEMFTSGTLRQYRLRHKRVNIRAVKHWCRQILRGLHYLHSHDPPVIHRDLKC
DNIFVNGNQGEVKIGDLGLAAILRKSHAAHCVGTPEFMAPEVYEEAYNELVDIYSFGMCI
LEMVTFDYPYSECTHPAQIYKKVMSGKKPDALYKVKDPEVKYFIEKCLATVSLRVSAREL
LDDPFLRIDDGEFDLRSVDMDDSVGPLVRQPHHLADYYNYPSNSSSLNRQYSNGYNGHHE
YPNGWAYNPAETEETHGIELFECRNENDQEEDKSSGNVDISIKGKRRDDGGLFLRLRITD
KEGRVRNIYFPFDIETDTALSVATEMVAELDMDDHGVTKIANMIDGEISSLVPGWRPGPE
FEESLAAAAAAHANANICSNCVSNRTSMGSVMDFLRTNPGANVAQCCRNGCGETHGRFEE
ITIRETEVRLREIWKLQQQQESRELSSIDSGQNHSEEEEEEEEEEEEEEEEAYENPEITF
SCEASNPINHLSGSGSFSFLPSIYCDELAEKTENQVQQELRWLKAKCQVEVRDMQDKHLK
SRWPESGEEADICRKDGFSESVDKVKEKTFGGSLVPKCLKRTTSLLVDAIDS
NT seq 1959 nt NT seq  +upstreamnt  +downstreamnt
atggaagattacagagcatttgatgagtatgaagggatagaagtagcatggaaccaagta
aagctctacgatttcttacagagccctgaggatcttgagaggctttactgtgagattcat
ctcctaaagaccctaaaacacaagaacatcatgaaattctacacctcttgggtcgatacc
gccaatcgaaacatcaattttgttactgaaatgttcacttctggcaccttaagacagtat
agactcaggcataagagagtgaacataagagcggtgaagcattggtgtagacagatcttg
agaggcctacattatcttcacagccacgaccctcctgtaatccacagggatctcaaatgt
gacaacattttcgttaatgggaatcaaggagaggtcaagattggagatcttggcctcgct
gccattttaagaaagtcccacgctgctcactgtgtcgggacgcctgagttcatggctcct
gaagtttacgaagaagcgtataacgaactggtcgatatatactctttcggtatgtgcatt
ttggaaatggttacgtttgattacccgtacagtgaatgtactcaccctgctcagatctac
aagaaagttatgtcgggaaagaaaccggatgcgttgtacaaggtgaaagaccccgaggtt
aaatatttcatagagaaatgcttggccacagtatcgcttagagtctctgctcgtgagtta
ctagatgacccttttcttcgaatagacgatggtgaatttgatttgagatcagttgatatg
gatgattccgtcgggccgctggttaggcagccacatcatcttgctgactactacaattac
ccgtcgaatagtagctctctgaatcgccagtactcaaatggttataacggccaccacgag
tatccaaacgggtgggcgtataatccagcagagacagaggagactcacggaatcgagctc
tttgagtgtcgaaacgaaaatgaccaagaagaagacaagagctctggtaatgttgatatt
agcatcaaaggcaagagaagagatgatggtggcttattcttgcgtcttaggatcactgac
aaagaagggcgtgtccggaacatttacttcccatttgacatcgagacagacacggcactg
agcgtagcaacagagatggtagcggaactggatatggacgatcacggagtcacaaaaatc
gccaacatgattgacggtgagatatcttctcttgtgcctggttggagacctggccctgaa
ttcgaagaatctcttgcggctgcagcagcggcacacgcgaacgcgaatatttgcagcaac
tgcgtatcaaaccgcacttcaatggggtcggtgatggatttcctgaggaccaaccctgga
gcaaatgttgcacaatgttgcagaaacggttgcggcgagactcatggccggtttgaagag
atcacaatcagagaaaccgaggttcgtcttagagagatctggaagctgcagcagcagcag
gaaagccgcgagcttagctcgatagattcggggcaaaaccactctgaagaagaagaagaa
gaagaagaagaagaagaagaagaggaagaagaggcatacgagaaccctgaaatcacgttt
tcttgcgaggcaagtaacccgataaaccacctatcggggtctggatcgttctcgtttttg
ccgtctatttactgcgatgagctagccgagaaaaccgaaaatcaggtccaacaggagtta
agatggcttaaagccaaatgtcaagttgaggtcagagatatgcaagataagcatttaaaa
tcccggtggccggaatccggagaagaggcggatatctgtcggaaagacggattctcggaa
tcggtagataaggtgaaagagaagacgtttggaggaagtttggtaccaaaatgtcttaag
aggacaacttcacttcttgttgatgccatcgattcttga

DBGET integrated database retrieval system