KEGG   Eutrema salsugineum: EUTSA_v10020923mgHelp
Entry
EUTSA_v10020923mg CDS       T02985                                 

Definition
(RefSeq) hypothetical protein
  KO
K20115  [pyruvate, phosphate dikinase]-phosphate phosphotransferase / [pyruvate, phosphate dikinase] kinase [EC:2.7.4.27 2.7.11.32]
Organism
eus  Eutrema salsugineum
Brite
KEGG Orthology (KO) [BR:eus00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    EUTSA_v10020923mg
Enzymes [BR:eus01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.27  [pyruvate, phosphate dikinase]-phosphate phosphotransferase
     EUTSA_v10020923mg
   2.7.11  Protein-serine/threonine kinases
    2.7.11.32  [pyruvate, phosphate dikinase] kinase
     EUTSA_v10020923mg
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Kinase-PPPase AAA_18
Motif
Other DBs
NCBI-GeneID: 18024068
NCBI-ProteinID: XP_006408472
UniProt: V4LHB8
Position
Unknown
AA seq 381 aa AA seqDB search
MNLHGVSGHPEPNSEPPITASSPPTPTPKLKISAKLNRWSRARALRSGVKIDRPINRSDN
TPCRQVTTEEAERKTSTIDGDDVEITAGKSIYLVSDGTGWTAEHSVNAALGQFEDRLVNR
GCSVNTHLFSWVEDEEKLMEIIKQAAKEKAMCFYTLANPSMAKSAKQACDLSGVLSVDIL
GPIIEGIASHLGVSPSGLTRGAAPGRVKTLNDAYFKRIEAIEFTIKQDDGTLPENLGKAD
IILVGVSRTGKTPLSTYIAQKGYKVANVPFVMGVEPPKTLFEVEPRKVFALKIELVVLQA
IRRTRAKTLGVDSVAENYYSGFDLVRKELDFASRIYAKNPGWSVIDVTNKAIEETAAVIL
RLYNHDGRESSTSVPCISKRY
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgaatttacacggcgtctcaggtcatcccgagcctaattccgaacctccgatcacagct
tcgagtcctccgactccgactccgaagctgaagattagtgccaaattgaatagatggtcc
agggcccgtgctttgcgatccggtgttaagatagaccgtccgattaaccgtagtgataac
acaccttgccgtcaagtaacgacggaggaggctgagaggaagacgtcgacgattgacggt
gatgacgtggagataacggcgggaaagtcgatatatttggtttccgacgggactgggtgg
acggcagagcactccgttaacgccgctttggggcaattcgaagatcgcttggtcaatcgt
ggttgttctgttaatacacacctcttctcttgggttgaggacgaggagaagctaatggag
ataatcaagcaggcggctaaagaaaaggcaatgtgtttctacactttagcaaacccttca
atggcgaaatccgcaaagcaagcttgcgatctaagtggcgtgctctcggttgatatacta
ggaccaatcatcgaagggatcgcgtctcacttaggcgtatctccgtcaggtctcacacgt
ggagcagctcccggtagggtcaagactctcaatgatgcatatttcaaaagaatcgaagcc
attgagtttaccatcaagcaagacgacgggactttacccgagaacttaggcaaggctgat
attattctggtcggggtctccaggacagggaagacgccattgtcgacttatattgctcaa
aaagggtacaaagtcgcaaatgtgccgtttgtgatgggtgtggaaccgcccaagacgctt
tttgaggttgaaccgagaaaagtttttgctttgaagattgagcttgttgttctgcaagcg
attaggagaacaagggctaaaacgttaggcgtggattcggtagcagagaactattactcg
ggcttcgatcttgttcgcaaagaactagatttcgcatcaaggatctatgccaaaaaccct
ggatggtctgtaatagatgtgacgaataaagcgattgaagaaaccgcagctgtgattctg
cggctttataaccatgacggtagagagagtagtactagtgtaccgtgtatatcaaaacgc
tactaa

DBGET integrated database retrieval system