KEGG   Eutrema salsugineum: EUTSA_v10021036mgHelp
Entry
EUTSA_v10021036mg CDS       T02985                                 

Definition
(RefSeq) hypothetical protein
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
eus  Eutrema salsugineum
Pathway
eus00260  Glycine, serine and threonine metabolism
eus01100  Metabolic pathways
eus01110  Biosynthesis of secondary metabolites
eus01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:eus00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    EUTSA_v10021036mg
Enzymes [BR:eus01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     EUTSA_v10021036mg
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Beta_elim_lyase DegT_DnrJ_EryC1 Aminotran_3 Cys_Met_Meta_PP Pyridoxal_deC
Motif
Other DBs
NCBI-GeneID: 18024328
NCBI-ProteinID: XP_006408182
UniProt: V4LGJ6
Position
Unknown
AA seq 352 aa AA seqDB search
MVTPTIRTVDLRSDTVTKPTESMRLAMANAEVDDDVLGNDPTAVRLEREVAEIAGKEAAM
FVPSGTMGNLISVLVHCDERGSEVIRGDDSHIHIYENGGVSSLGGVHPRTVKNEEDGTME
IGSIEAAVRSPKGDLHYPVTKLICLENTQANCGGRCLPIEYIDKVGELAEKHGLKLHIDG
ARIFNASLALGVPVKRIVQAADSVSICLSKGIGAPVGSVIVGSKSFITKARWLRKTLGGG
MRQIGVLCAAALVALHENVAKLDDDHKKAKILAEGLNRIERLRVDVTAVETNIIYVDIPK
DPKFRAEDACKSLEVLGVLVIPQATFRIRIVLHHQISDSDVEYVLSCFEKTF
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atggtaacgccaacaataagaaccgttgatctccggtccgacacggtgactaagccaacg
gagtcaatgcgtttagcgatggcaaacgcggaagtagacgacgacgttttgggaaatgat
ccaaccgccgtgcgtttggagagagaggtggcagagatcgccggaaaagaggcggccatg
tttgttccgtcggggacaatggggaatctgataagtgtattggtccattgtgatgagagg
gggagtgaagtgattcgaggagatgactctcacattcatatatacgaaaacggcggcgtt
tcaagcctcggcggagtgcatcctaggacggtgaagaacgaagaagacgggacgatggag
attggttctattgaggctgccgtgaggagtcccaaaggagatcttcattatccggttact
aagcttatatgtcttgagaacactcaagcaaattgtggaggtagatgcttgcctatagaa
tatatagacaaagtcggagaattagccgagaaacatggcttgaagcttcacatcgacgga
gctcggatcttcaacgcttctcttgcgctcggagtaccggtcaagaggattgttcaagcc
gcagattcggtctcgatatgtttgtcgaaaggtataggtgcaccggttggctcggtaatt
gtgggaagcaaaagtttcatcaccaaagcaaggtggttaaggaaaacattaggtggagga
atgagacagatcggtgtgctctgcgctgcggcattggtggctctccatgaaaacgtcgcc
aagctcgacgatgatcacaagaaggccaagatcttggcagaaggactgaaccggattgaa
cggttaagagtggacgtcacggcggtggaaacaaacatcatatacgtagatataccaaaa
gatccaaaatttagagcagaagacgcatgcaaaagtttggaagttctcggtgtgcttgtc
atacctcaagctacattcagaatcaggattgttctacaccaccaaatctcagatagcgac
gtggaatatgtactctcttgttttgagaaaacgttttag

DBGET integrated database retrieval system