KEGG   Eutrema salsugineum: EUTSA_v10022839mgHelp
Entry
EUTSA_v10022839mg CDS       T02985                                 

Definition
(RefSeq) hypothetical protein
  KO
K03936  NADH dehydrogenase (ubiquinone) Fe-S protein 3 [EC:7.1.1.2 1.6.99.3]
Organism
eus  Eutrema salsugineum
Pathway
eus00190  Oxidative phosphorylation
eus01100  Metabolic pathways
Module
eus_M00143  NADH dehydrogenase (ubiquinone) Fe-S protein/flavoprotein complex, mitochondria
Brite
KEGG Orthology (KO) [BR:eus00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    EUTSA_v10022839mg
Enzymes [BR:eus01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.99  With unknown physiological acceptors
    1.6.99.3  NADH dehydrogenase
     EUTSA_v10022839mg
 7. Translocases
  7.1  Catalysing the translocation of hydrons
   7.1.1  Linked to oxidoreductase reactions
    7.1.1.2  NADH:ubiquinone reductase (H+-translocating)
     EUTSA_v10022839mg
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Complex1_30kDa
Motif
Other DBs
NCBI-GeneID: 18025927
NCBI-ProteinID: XP_006409508
UniProt: V4NVU5
Position
Unknown
AA seq 224 aa AA seqDB search
MPFLVGPTGTGNFRRVFQNLKSKKRNYKKAFFIFMDNQSIFQYSWETLPKKWVKKMERSE
HGNRSDTNTDYLFQLLCFLKLHTYTRVQVSIDICGVDHPSRKRRFEVVYNLLSTRYNSRI
RVQTSADEVTRISPVVSLFPSAGRWEREVWDMFGVSFINHPDLRRISTDYGFEGHPLRKD
LPLSGYVEVRYDDPEKRVVSEPIEMTQEFRYFDFASPWEQRSDG
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atgcctttcttggttggaccaaccggcaccggcaatttccgacgagtctttcagaatttg
aagagcaagaagcggaactacaagaaagctttctttatctttatggataaccaatccatt
ttccaatatagttgggagactttacccaaaaaatgggtaaaaaaaatggaaagatcggaa
catgggaatagatctgataccaatacggactacctatttcaattgttgtgctttctcaaa
ttgcatacctatacaagggttcaagtttcgatcgatatttgcggagttgatcatccctct
cgaaaacgaagatttgaagtggtctataatttactgagtactcggtataactcacgcatt
cgtgtacaaaccagtgcagacgaagtaacacgaatatctccggtagtaagtctatttcca
tcagccggccggtgggagcgagaagtttgggatatgtttggtgtttctttcatcaatcat
ccggatctacgccgtatatcaacagattatggtttcgagggtcatccattacgaaaagac
cttcctctgagtggatatgtggaagtacgctatgatgatccagagaaacgtgttgtttct
gaacccattgagatgacccaagaatttcgctatttcgattttgctagtccttgggaacag
cgtagcgacggataa

DBGET integrated database retrieval system