KEGG   Eutrema salsugineum: EUTSA_v10023866mgHelp
Entry
EUTSA_v10023866mg CDS       T02985                                 

Definition
(RefSeq) hypothetical protein
  KO
K15014  solute carrier family 29 (equilibrative nucleoside transporter), member 1/2/3
Organism
eus  Eutrema salsugineum
Brite
KEGG Orthology (KO) [BR:eus00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:eus02000]
    EUTSA_v10023866mg
Transporters [BR:eus02000]
 Solute Carrier Family (SLC)
  SLC29: Facilitative nucleoside transporter
   EUTSA_v10023866mg
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Nucleoside_tran
Motif
Other DBs
NCBI-GeneID: 18009532
NCBI-ProteinID: XP_006391987
UniProt: V4KPH8
Position
Unknown
AA seq 417 aa AA seqDB search
MSNPEDIPSRLEGKNVARLVCCILGVGSLVAWNAMLTITDYYYHVFPKYHPSRVLTIVYQ
LVANVFISTLAYKEAKLNTRKRNIFGYGLYTFGTFLLIVLDLASHGSGSVGAYVALCLIV
ALFGFADAFVQGGMVGDLSFMCPEFIQAFMGGLGIAGALTSVLRLITKAIFDKSSDGLRK
GALLFIGIATLIELACLILYVSVFAKLPIVKYYRAKAGKEGAKSVAADLAAGGLQEQAAQ
VQQMDETKIIRQTKKQLLRQNVDHMLNLFLIYVVTLSIFPGFLYENTGEHRLGDWYAPVL
VAMYNGWDSISRFIPSIKRLALESRKWITVCVVARFLLVPAFYFTAKYADQGWMIFLTSF
LGLSNGYLTVSIFSIAPKGYNGPDSNALGNLLCVFLLGGIFAGVCLGWLWLIGNDSF
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atgagtaatccagaggatattcctagcagacttgagggcaagaatgtagcacgacttgtg
tgttgtattcttggagtaggttctctcgtggcatggaatgcaatgctgaccatcacagac
tattattatcacgtttttccgaaatatcatccttcgagggtgcttacaatagtttaccaa
ctggttgcgaatgtgtttatatcaacacttgcttataaagaagctaagctcaatacccga
aaacgtaacattttcgggtatggcctttatacctttggcacctttcttctcatcgtgttg
gatcttgcttcccatggcagtggaagtgtaggagcatatgttgcgttgtgtttgattgtt
gctctttttggattcgctgatgcttttgtacaaggtggaatggttggagatttgtccttc
atgtgccccgagttcatccaggcattcatgggaggtttaggcatagccggagctctaacc
tccgttttaaggcttattacaaaagccatattcgacaagtcttctgatggtctccgaaaa
ggcgctttgttgttcattggaatagctacattgatcgagctagcatgtctcattctatat
gtgtctgtcttcgctaagctccctatcgtaaaatactaccgtgccaaagccgggaaagaa
ggtgcgaaatccgttgctgccgatctagctgccggtggcctccaagaacaggctgcacag
gttcaacaaatggacgagaccaagatcataaggcaaaccaagaagcaattgctacgacaa
aacgtagatcatatgctcaatctcttcttgatttacgtcgttacgttatcgattttcccg
ggatttctatacgaaaacacaggagaacatcgattaggcgattggtatgcaccggtccta
gtagcaatgtacaacgggtgggattcgatttcgaggttcattccctcgatcaaacgtcta
gcattggagtctaggaagtggatcacggtctgcgttgttgcgcgtttcttgctcgtccct
gccttttactttaccgctaaatacgcggatcaaggatggatgattttcctcacctctttc
ttgggattgagtaacggttatttaaccgtctctatcttcagcattgcaccaaagggttac
aatggaccggactcgaatgcattagggaacttgttgtgcgtgtttctattgggaggtatc
ttcgctggagtttgtttgggttggctttggctcattggcaacgattcgttttag

DBGET integrated database retrieval system