KEGG   Eutrema salsugineum: EUTSA_v10024544mgHelp
Entry
EUTSA_v10024544mg CDS       T02985                                 

Definition
(RefSeq) hypothetical protein
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
eus  Eutrema salsugineum
Pathway
eus03040  Spliceosome
eus04141  Protein processing in endoplasmic reticulum
eus04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:eus00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    EUTSA_v10024544mg
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    EUTSA_v10024544mg
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    EUTSA_v10024544mg
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:eus01009]
    EUTSA_v10024544mg
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:eus03041]
    EUTSA_v10024544mg
   03009 Ribosome biogenesis [BR:eus03009]
    EUTSA_v10024544mg
   03110 Chaperones and folding catalysts [BR:eus03110]
    EUTSA_v10024544mg
   04131 Membrane trafficking [BR:eus04131]
    EUTSA_v10024544mg
   03051 Proteasome [BR:eus03051]
    EUTSA_v10024544mg
   03029 Mitochondrial biogenesis [BR:eus03029]
    EUTSA_v10024544mg
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:eus04147]
    EUTSA_v10024544mg
Protein phosphatases and associated proteins [BR:eus01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     EUTSA_v10024544mg
Spliceosome [BR:eus03041]
 Complex B
  Other components
   Prp19 complex
    EUTSA_v10024544mg
 Complex C
   Prp19-CDC5 complex
    EUTSA_v10024544mg
Ribosome biogenesis [BR:eus03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    EUTSA_v10024544mg
Chaperones and folding catalysts [BR:eus03110]
 Heat shock proteins
  HSP70 / DNAK
   EUTSA_v10024544mg
Membrane trafficking [BR:eus04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    EUTSA_v10024544mg
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    EUTSA_v10024544mg
Proteasome [BR:eus03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    EUTSA_v10024544mg
Mitochondrial biogenesis [BR:eus03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    EUTSA_v10024544mg
Exosome [BR:eus04147]
 Exosomal proteins
  Proteins found in most exosomes
   EUTSA_v10024544mg
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl FtsA StbA FGGY_C DUF5398 Hydantoinase_A
Motif
Other DBs
NCBI-GeneID: 18031069
NCBI-ProteinID: XP_006413448
UniProt: V4P5V4
Position
Unknown
AA seq 713 aa AA seqDB search
MASSSAQIHVLGGIGFATSSSKRNLNGKGSFMPRSAFFGTRTGPFSTPTSAFLKMNSRNG
SRYAVGPVRVVNEKVVGIDLGTTNSAVAAMEGGKPTIVTNAEGQRTTPSVVAYTKSGDRL
VGQIAKRQAVVNPENTFFSVKRFIGRRMNEVDEEAKQVSYRVVRDENGNVKLECPAIGKQ
FAAEEISAQVLRKLVDDASRFLNEKVTKAVVTVPAYFNDSQRTATKDAGRIAGLEVLRII
NEPTAASLAYGFERKSNETILVFDLGGGTFDVSVLEVGDGVFEVLSTSGDTHLGGDDFDK
RVVDWLASNFKKDEGIDLLKDKQALQRLTEAAEKAKIELSSLTQTNMSLPFITATADGPK
HIETTLTRAKFEELCSDLLDRCKTPVENSLRDAKLSFKDIDEVILVGGSTRIPAVQEVVR
KLTGKEPNVTVNPDEVVALGAAVQAGVLAGDVSDIVLLDVTPLSIGLETLGGVMTKIIPR
NSTLPTSKSEVFSTAADGQTSVEINVLQGEREFVRDNKSLGSFRLDGIPPAPRGVPQIEV
KFDIDANGILSVSASDKGTGKKQDITITGASTLPKDEVEQMVQEAERFAKDDKEKRDAID
TKNQADSVVYQTEKQLKELGDKIPGEVKEKVEAKLQELKDKIGSGSTQEIKDTMAALNQE
VMQIGQSMYNQPGAGAGAAGPGPSPGGEGASSTDSSSSKGGDDVIDADFTDSK
NT seq 2142 nt NT seq  +upstreamnt  +downstreamnt
atggcttcatcctccgcccaaattcacgttctcggcggaattggattcgccacttcttct
tccaagaggaatctcaatggtaaaggtagcttcatgccaagaagcgccttcttcggcaca
agaacgggccctttctccactcctacttctgccttcctcaaaatgaatagcagaaatggc
tcaaggtacgcagttggtcccgtgcgcgtggttaacgagaaggtcgttggaatcgatttg
ggtacgactaactccgccgtagctgccatggaaggaggcaagcctacgattgtgacgaac
gctgagggtcagaggacgacgccgtctgtggtggcgtacacgaagagcggtgaccggctt
gtcgggcagattgcgaagcggcaagccgttgttaatcctgagaacactttcttctcggta
aagaggtttattggtaggaggatgaacgaggtagatgaggaggctaagcaggtttcatac
cgagttgttagggatgagaacggaaatgtcaagctggagtgtcctgccattggcaaacaa
tttgctgctgaggaaatctcagctcaggttctgaggaaactcgtggatgatgcttcaaga
tttttgaacgaaaaagtaaccaaggctgtcgtcactgtacctgcttacttcaacgactca
cagaggacagctacgaaagatgctggtcgcattgctgggctggaagttcttcgtattatt
aatgagcccactgctgcttcattggcttatggatttgagagaaaaagcaacgaaacaatt
ctagtctttgatcttggtggtggtacctttgatgtctcagtgcttgaggttggtgatggt
gtgtttgaagtgctttccacctctggagacacccatttgggtggagatgactttgacaag
agagttgttgattggcttgcttcaaatttcaagaaagatgaaggcattgatcttctgaaa
gataagcaagcacttcagagattgacagaggcagcggaaaaagctaaaattgagctttcc
tccctgactcagacaaatatgagcttaccatttatcacggccacagctgatggacctaaa
cacatagaaaccaccctgacacgtgccaagttcgaagaattgtgttcagatttacttgac
aggtgtaagactcccgttgagaattccctgagagatgcaaagctcagtttcaaagatatt
gatgaagtaatccttgttggtggatccacacgtattcctgctgttcaggaagtcgtcagg
aagctgactgggaaagaacccaatgtgacagtaaatcctgatgaggttgttgccctaggt
gctgcagtccaggctggtgttctggctggagatgtgagtgacattgtgcttctcgatgtg
acaccactttcgattggtttggaaactcttggtggtgtgatgactaagattattccaagg
aactctacactgcctacttccaagtcagaagtcttctcgactgctgctgatggacagaca
agtgttgagattaatgtgctgcagggtgagagggagtttgtccgggataacaagtctctt
ggcagcttccgtttagatggtatccctccggcaccacgtggagttccacaaatcgaagtc
aaatttgacatcgatgccaatggaatcctatccgtgagtgcgagtgacaaaggcaccgga
aagaaacaagacatcaccattactggtgccagtacattgcccaaggatgaggtagagcaa
atggtgcaagaagcagaaaggtttgcaaaggatgacaaggagaagagagacgcaattgac
acaaagaaccaagcagattcggtggtgtaccagacagagaagcaacttaaagaacttgga
gataaaatcccaggtgaagtgaaagagaaggtggaggctaagctacaggagctgaaagac
aagattggaagcggatcaacccaggaaatcaaagatacaatggctgctctaaaccaagaa
gtgatgcagattggccagtctatgtacaaccagccaggagctggagcaggagctgcaggt
ccaggtccttcccctggaggtgaaggtgcttcatcaacagattcatcgtcaagcaaaggt
ggtgatgatgtgatcgatgccgactttacagacagcaaatga

DBGET integrated database retrieval system