KEGG   Eutrema salsugineum: EUTSA_v10025515mgHelp
Entry
EUTSA_v10025515mg CDS       T02985                                 

Definition
(RefSeq) hypothetical protein
Organism
eus  Eutrema salsugineum
SSDB OrthologParalogGFIT
Motif
Pfam: MMR_HSR1_Xtn TGS MMR_HSR1 FeoB_N Dynamin_N MeaB AIG1 ABC_tran
Motif
Other DBs
NCBI-GeneID: 18029046
NCBI-ProteinID: XP_006411751
UniProt: V4MA25
Position
Unknown
AA seq 368 aa AA seqDB search
MSTIMQKIKEIEDEMARTQKNKATAHHLGLLKAKLAKLRRDLLAPPTKGGGGAGEGFDVT
KSGDSRVGLVGFPSVGKSTLLNKLTGTFSEVASYEFTTLTCIPGVITYRGAKIQLLDLPG
IIEGAKDGKGRGRQVISTARTCNCILIVLDAIKPITHKRLIEKELEGFGIRLNKEPPNLT
FRKKDKGGINLTSTVTSTHLDLDTVKAICSEYRIHNADITLRYDATADDLIDVIEGSRIY
MPCIYAVNKIDQITLEELEILDKLPHYCPISAHLEWNLDGLLDKIWEYLDLTRIYTKPKA
MNPDYDDPVILSSKKRTVEDFCIRIHKDMLKQFKYALVWGSSAKHKPQRVGREHELEDED
VVQIVKKI
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgtcgactattatgcagaagatcaaagaaatcgaagatgagatggctaggacacagaag
aataaagctactgcgcatcatctgggtttgttaaaggccaaacttgctaagctacgaagg
gaccttcttgcaccacctaccaaaggtggtggtggtgctggtgaaggttttgatgtgacg
aaaagtggagattctagagttggacttgttgggtttccttcggttggaaaatccacgctc
ttgaacaagcttactggaacattctccgaggttgcttcttatgagttcacaacattgaca
tgcattcccggagttattacataccgtggagctaaaatccagttattagatcttcctggt
attattgagggtgctaaggacggaaagggtagagggcgacaggttataagtactgctagg
acttgcaactgcatcttgattgttcttgatgccataaaaccaataactcacaagcgtctc
atcgaaaaagagctcgaaggattcggaataaggttgaacaaggagccacctaatcttaca
ttcaggaaaaaagacaaaggtggtatcaatctaacttctacagtcacttccacacacctt
gacctcgacactgtcaaggcgatttgcagtgagtacaggattcacaacgctgacatcact
ctgcgctacgatgcaactgctgatgacctcatcgatgtcatcgagggcagccggatctat
atgccctgtatctacgctgtcaacaagattgatcaaatcacactcgaggaacttgaaatt
ttggacaaacttcctcattactgtcctatcagtgcacatttggagtggaatcttgacggt
cttctggataagatatgggaatacttggatctaactcgaatctacacgaaaccaaaggca
atgaatccggactatgatgaccccgttatcttatcttccaagaagagaacagttgaggac
ttctgcatccggattcacaaagacatgcttaaacagttcaagtacgctctggtttggggt
tcgagtgccaaacacaagccacaaagagttggaagggaacacgagcttgaggacgaggat
gttgttcagatcgttaaaaagatatga

DBGET integrated database retrieval system